data_1SZI # _entry.id 1SZI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1SZI RCSB RCSB022125 WWPDB D_1000022125 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SZI _pdbx_database_status.recvd_initial_deposition_date 2004-04-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hickenbottom, S.J.' 1 'Kimmel, A.R.' 2 'Londos, C.' 3 'Hurley, J.H.' 4 # _citation.id primary _citation.title 'Structure of a Lipid Droplet Protein: The PAT Family Member TIP47' _citation.journal_abbrev Structure _citation.journal_volume 12 _citation.page_first 1199 _citation.page_last 1207 _citation.year 2004 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15242596 _citation.pdbx_database_id_DOI 10.1016/j.str.2004.04.021 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hickenbottom, S.J.' 1 primary 'Kimmel, A.R.' 2 primary 'Londos, C.' 3 primary 'Hurley, J.H.' 4 # _cell.entry_id 1SZI _cell.length_a 118.746 _cell.length_b 118.746 _cell.length_c 97.291 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SZI _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'mannose-6-phosphate receptor binding protein 1' _entity.formula_weight 27569.863 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name TIP47 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGVDRVLVKSEAWADNRLPLTEAELALIATPPEDSDMASLQQQRQEQNYFVRLGSLSERLRNHAYEHSLGKLQNARQKAQ ETLQQLTSVLGLMESVKQGVDQRLGEGQEKLHQMWLSWNQKTPQDAEKDPAKPEQVEARALSMFRDITQQLQSMCVALGA SIQGLPSHVREQAQQARSQVNDLQATFSGIHSFQDLSAGVLAQTRERIARAREALDNTVEYVAQNTPAMWLVGPFAPGIT EKTPEGK ; _entity_poly.pdbx_seq_one_letter_code_can ;SGVDRVLVKSEAWADNRLPLTEAELALIATPPEDSDMASLQQQRQEQNYFVRLGSLSERLRNHAYEHSLGKLQNARQKAQ ETLQQLTSVLGLMESVKQGVDQRLGEGQEKLHQMWLSWNQKTPQDAEKDPAKPEQVEARALSMFRDITQQLQSMCVALGA SIQGLPSHVREQAQQARSQVNDLQATFSGIHSFQDLSAGVLAQTRERIARAREALDNTVEYVAQNTPAMWLVGPFAPGIT EKTPEGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 VAL n 1 4 ASP n 1 5 ARG n 1 6 VAL n 1 7 LEU n 1 8 VAL n 1 9 LYS n 1 10 SER n 1 11 GLU n 1 12 ALA n 1 13 TRP n 1 14 ALA n 1 15 ASP n 1 16 ASN n 1 17 ARG n 1 18 LEU n 1 19 PRO n 1 20 LEU n 1 21 THR n 1 22 GLU n 1 23 ALA n 1 24 GLU n 1 25 LEU n 1 26 ALA n 1 27 LEU n 1 28 ILE n 1 29 ALA n 1 30 THR n 1 31 PRO n 1 32 PRO n 1 33 GLU n 1 34 ASP n 1 35 SER n 1 36 ASP n 1 37 MET n 1 38 ALA n 1 39 SER n 1 40 LEU n 1 41 GLN n 1 42 GLN n 1 43 GLN n 1 44 ARG n 1 45 GLN n 1 46 GLU n 1 47 GLN n 1 48 ASN n 1 49 TYR n 1 50 PHE n 1 51 VAL n 1 52 ARG n 1 53 LEU n 1 54 GLY n 1 55 SER n 1 56 LEU n 1 57 SER n 1 58 GLU n 1 59 ARG n 1 60 LEU n 1 61 ARG n 1 62 ASN n 1 63 HIS n 1 64 ALA n 1 65 TYR n 1 66 GLU n 1 67 HIS n 1 68 SER n 1 69 LEU n 1 70 GLY n 1 71 LYS n 1 72 LEU n 1 73 GLN n 1 74 ASN n 1 75 ALA n 1 76 ARG n 1 77 GLN n 1 78 LYS n 1 79 ALA n 1 80 GLN n 1 81 GLU n 1 82 THR n 1 83 LEU n 1 84 GLN n 1 85 GLN n 1 86 LEU n 1 87 THR n 1 88 SER n 1 89 VAL n 1 90 LEU n 1 91 GLY n 1 92 LEU n 1 93 MET n 1 94 GLU n 1 95 SER n 1 96 VAL n 1 97 LYS n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 ASP n 1 102 GLN n 1 103 ARG n 1 104 LEU n 1 105 GLY n 1 106 GLU n 1 107 GLY n 1 108 GLN n 1 109 GLU n 1 110 LYS n 1 111 LEU n 1 112 HIS n 1 113 GLN n 1 114 MET n 1 115 TRP n 1 116 LEU n 1 117 SER n 1 118 TRP n 1 119 ASN n 1 120 GLN n 1 121 LYS n 1 122 THR n 1 123 PRO n 1 124 GLN n 1 125 ASP n 1 126 ALA n 1 127 GLU n 1 128 LYS n 1 129 ASP n 1 130 PRO n 1 131 ALA n 1 132 LYS n 1 133 PRO n 1 134 GLU n 1 135 GLN n 1 136 VAL n 1 137 GLU n 1 138 ALA n 1 139 ARG n 1 140 ALA n 1 141 LEU n 1 142 SER n 1 143 MET n 1 144 PHE n 1 145 ARG n 1 146 ASP n 1 147 ILE n 1 148 THR n 1 149 GLN n 1 150 GLN n 1 151 LEU n 1 152 GLN n 1 153 SER n 1 154 MET n 1 155 CYS n 1 156 VAL n 1 157 ALA n 1 158 LEU n 1 159 GLY n 1 160 ALA n 1 161 SER n 1 162 ILE n 1 163 GLN n 1 164 GLY n 1 165 LEU n 1 166 PRO n 1 167 SER n 1 168 HIS n 1 169 VAL n 1 170 ARG n 1 171 GLU n 1 172 GLN n 1 173 ALA n 1 174 GLN n 1 175 GLN n 1 176 ALA n 1 177 ARG n 1 178 SER n 1 179 GLN n 1 180 VAL n 1 181 ASN n 1 182 ASP n 1 183 LEU n 1 184 GLN n 1 185 ALA n 1 186 THR n 1 187 PHE n 1 188 SER n 1 189 GLY n 1 190 ILE n 1 191 HIS n 1 192 SER n 1 193 PHE n 1 194 GLN n 1 195 ASP n 1 196 LEU n 1 197 SER n 1 198 ALA n 1 199 GLY n 1 200 VAL n 1 201 LEU n 1 202 ALA n 1 203 GLN n 1 204 THR n 1 205 ARG n 1 206 GLU n 1 207 ARG n 1 208 ILE n 1 209 ALA n 1 210 ARG n 1 211 ALA n 1 212 ARG n 1 213 GLU n 1 214 ALA n 1 215 LEU n 1 216 ASP n 1 217 ASN n 1 218 THR n 1 219 VAL n 1 220 GLU n 1 221 TYR n 1 222 VAL n 1 223 ALA n 1 224 GLN n 1 225 ASN n 1 226 THR n 1 227 PRO n 1 228 ALA n 1 229 MET n 1 230 TRP n 1 231 LEU n 1 232 VAL n 1 233 GLY n 1 234 PRO n 1 235 PHE n 1 236 ALA n 1 237 PRO n 1 238 GLY n 1 239 ILE n 1 240 THR n 1 241 GLU n 1 242 LYS n 1 243 THR n 1 244 PRO n 1 245 GLU n 1 246 GLY n 1 247 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-DE3CodonPlus RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'HIS parallel 2' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9DBG5_MOUSE _struct_ref.pdbx_db_accession Q9DBG5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGVDRVLVKSEAWADNRLPLTEAELALIATPPEDSDMASLQQQRQEQNYFVRLGSLSERLRNHAYEHSLGKLQNARQKAQ ETLQQLTSVLGLMESVKQGVDQRLGEGQEKLHQMWLSWNQKTPQDAEKDPAKPEQVEARALSMFRDITQQLQSMCVALGA SIQGLPSHVREQAQQARSQVNDLQATFSGIHSFQDLSAGVLAQTRERIARAREALDNTVEYVAQNTPAMWLVGPFAPGIT EKTPEGK ; _struct_ref.pdbx_align_begin 191 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SZI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 247 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9DBG5 _struct_ref_seq.db_align_beg 191 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 437 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 191 _struct_ref_seq.pdbx_auth_seq_align_end 437 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1SZI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 4 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.59 _exptl_crystal.density_percent_sol 65.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.50 _exptl_crystal_grow.pdbx_details 'Sodium Citrate, Tris-HCl, sodium Chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.15K, pH 8.50' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _reflns.entry_id 1SZI _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.0 _reflns.d_resolution_high 2.80 _reflns.number_obs ? _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1SZI _refine.ls_number_reflns_obs 9931 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.00 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.238 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.236 _refine.ls_R_factor_R_free 0.272 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 500 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.914 _refine.correlation_coeff_Fo_to_Fc_free 0.902 _refine.B_iso_mean 55.42 _refine.aniso_B[1][1] 1.44000 _refine.aniso_B[2][2] 1.44000 _refine.aniso_B[3][3] -2.16000 _refine.aniso_B[1][2] 0.72000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.418 _refine.pdbx_overall_ESU_R_Free 0.302 _refine.overall_SU_ML 0.205 _refine.overall_SU_B 10.356 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1512 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1512 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 40.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.008 0.021 ? 1525 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.331 1.952 ? 2062 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 0.892 5.000 ? 192 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.088 0.200 ? 235 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 1163 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.280 0.200 ? 794 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.141 0.200 ? 58 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.319 0.200 ? 37 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.183 0.200 ? 5 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 11.129 1.500 ? 967 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 13.405 2.000 ? 1545 'X-RAY DIFFRACTION' ? r_scbond_it 23.236 3.000 ? 558 'X-RAY DIFFRACTION' ? r_scangle_it 27.675 4.500 ? 517 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.87 _refine_ls_shell.number_reflns_R_work 704 _refine_ls_shell.R_factor_R_work 0.375 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.472 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1SZI _struct.title 'Crystal Structure of the C-terminus of TIP47' _struct.pdbx_descriptor 'mannose-6-phosphate receptor binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SZI _struct_keywords.pdbx_keywords 'LIPID BINDING, PEPTIDE BINDING' _struct_keywords.text '4-helix bundle, alpha/beta domain, PAT protein, LIPID BINDING, PEPTIDE BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 21 ? LEU A 27 ? THR A 211 LEU A 217 1 ? 7 HELX_P HELX_P2 2 ASP A 36 ? GLU A 46 ? ASP A 226 GLU A 236 1 ? 11 HELX_P HELX_P3 3 GLY A 54 ? LEU A 56 ? GLY A 244 LEU A 246 5 ? 3 HELX_P HELX_P4 4 SER A 57 ? GLN A 98 ? SER A 247 GLN A 288 1 ? 42 HELX_P HELX_P5 5 PRO A 133 ? SER A 161 ? PRO A 323 SER A 351 1 ? 29 HELX_P HELX_P6 6 PRO A 166 ? PHE A 187 ? PRO A 356 PHE A 377 1 ? 22 HELX_P HELX_P7 7 SER A 188 ? ILE A 190 ? SER A 378 ILE A 380 5 ? 3 HELX_P HELX_P8 8 SER A 192 ? LEU A 196 ? SER A 382 LEU A 386 5 ? 5 HELX_P HELX_P9 9 SER A 197 ? GLN A 224 ? SER A 387 GLN A 414 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 233 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 423 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 234 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 424 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.03 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 17 ? LEU A 18 ? ARG A 207 LEU A 208 A 2 LEU A 231 ? PRO A 237 ? LEU A 421 PRO A 427 A 3 TYR A 49 ? ARG A 52 ? TYR A 239 ARG A 242 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 18 ? N LEU A 208 O ALA A 236 ? O ALA A 426 A 2 3 O VAL A 232 ? O VAL A 422 N VAL A 51 ? N VAL A 241 # _database_PDB_matrix.entry_id 1SZI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SZI _atom_sites.fract_transf_matrix[1][1] 0.008421 _atom_sites.fract_transf_matrix[1][2] 0.004862 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009724 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010278 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 191 ? ? ? A . n A 1 2 GLY 2 192 ? ? ? A . n A 1 3 VAL 3 193 ? ? ? A . n A 1 4 ASP 4 194 ? ? ? A . n A 1 5 ARG 5 195 ? ? ? A . n A 1 6 VAL 6 196 ? ? ? A . n A 1 7 LEU 7 197 ? ? ? A . n A 1 8 VAL 8 198 ? ? ? A . n A 1 9 LYS 9 199 ? ? ? A . n A 1 10 SER 10 200 ? ? ? A . n A 1 11 GLU 11 201 ? ? ? A . n A 1 12 ALA 12 202 ? ? ? A . n A 1 13 TRP 13 203 ? ? ? A . n A 1 14 ALA 14 204 ? ? ? A . n A 1 15 ASP 15 205 ? ? ? A . n A 1 16 ASN 16 206 206 ASN ASN A . n A 1 17 ARG 17 207 207 ARG ARG A . n A 1 18 LEU 18 208 208 LEU LEU A . n A 1 19 PRO 19 209 209 PRO PRO A . n A 1 20 LEU 20 210 210 LEU LEU A . n A 1 21 THR 21 211 211 THR THR A . n A 1 22 GLU 22 212 212 GLU GLU A . n A 1 23 ALA 23 213 213 ALA ALA A . n A 1 24 GLU 24 214 214 GLU GLU A . n A 1 25 LEU 25 215 215 LEU LEU A . n A 1 26 ALA 26 216 216 ALA ALA A . n A 1 27 LEU 27 217 217 LEU LEU A . n A 1 28 ILE 28 218 218 ILE ILE A . n A 1 29 ALA 29 219 219 ALA ALA A . n A 1 30 THR 30 220 220 THR THR A . n A 1 31 PRO 31 221 221 PRO PRO A . n A 1 32 PRO 32 222 222 PRO PRO A . n A 1 33 GLU 33 223 223 GLU GLU A . n A 1 34 ASP 34 224 224 ASP ASP A . n A 1 35 SER 35 225 225 SER SER A . n A 1 36 ASP 36 226 226 ASP ASP A . n A 1 37 MET 37 227 227 MET MET A . n A 1 38 ALA 38 228 228 ALA ALA A . n A 1 39 SER 39 229 229 SER SER A . n A 1 40 LEU 40 230 230 LEU LEU A . n A 1 41 GLN 41 231 231 GLN GLN A . n A 1 42 GLN 42 232 232 GLN GLN A . n A 1 43 GLN 43 233 233 GLN GLN A . n A 1 44 ARG 44 234 234 ARG ARG A . n A 1 45 GLN 45 235 235 GLN GLN A . n A 1 46 GLU 46 236 236 GLU GLU A . n A 1 47 GLN 47 237 237 GLN GLN A . n A 1 48 ASN 48 238 238 ASN ASN A . n A 1 49 TYR 49 239 239 TYR TYR A . n A 1 50 PHE 50 240 240 PHE PHE A . n A 1 51 VAL 51 241 241 VAL VAL A . n A 1 52 ARG 52 242 242 ARG ARG A . n A 1 53 LEU 53 243 243 LEU LEU A . n A 1 54 GLY 54 244 244 GLY GLY A . n A 1 55 SER 55 245 245 SER SER A . n A 1 56 LEU 56 246 246 LEU LEU A . n A 1 57 SER 57 247 247 SER SER A . n A 1 58 GLU 58 248 248 GLU GLU A . n A 1 59 ARG 59 249 249 ARG ARG A . n A 1 60 LEU 60 250 250 LEU LEU A . n A 1 61 ARG 61 251 251 ARG ARG A . n A 1 62 ASN 62 252 252 ASN ASN A . n A 1 63 HIS 63 253 253 HIS HIS A . n A 1 64 ALA 64 254 254 ALA ALA A . n A 1 65 TYR 65 255 255 TYR TYR A . n A 1 66 GLU 66 256 256 GLU GLU A . n A 1 67 HIS 67 257 257 HIS HIS A . n A 1 68 SER 68 258 258 SER SER A . n A 1 69 LEU 69 259 259 LEU LEU A . n A 1 70 GLY 70 260 260 GLY GLY A . n A 1 71 LYS 71 261 261 LYS LYS A . n A 1 72 LEU 72 262 262 LEU LEU A . n A 1 73 GLN 73 263 263 GLN GLN A . n A 1 74 ASN 74 264 264 ASN ASN A . n A 1 75 ALA 75 265 265 ALA ALA A . n A 1 76 ARG 76 266 266 ARG ARG A . n A 1 77 GLN 77 267 267 GLN GLN A . n A 1 78 LYS 78 268 268 LYS LYS A . n A 1 79 ALA 79 269 269 ALA ALA A . n A 1 80 GLN 80 270 270 GLN GLN A . n A 1 81 GLU 81 271 271 GLU GLU A . n A 1 82 THR 82 272 272 THR THR A . n A 1 83 LEU 83 273 273 LEU LEU A . n A 1 84 GLN 84 274 274 GLN GLN A . n A 1 85 GLN 85 275 275 GLN GLN A . n A 1 86 LEU 86 276 276 LEU LEU A . n A 1 87 THR 87 277 277 THR THR A . n A 1 88 SER 88 278 278 SER SER A . n A 1 89 VAL 89 279 279 VAL VAL A . n A 1 90 LEU 90 280 280 LEU LEU A . n A 1 91 GLY 91 281 281 GLY GLY A . n A 1 92 LEU 92 282 282 LEU LEU A . n A 1 93 MET 93 283 283 MET MET A . n A 1 94 GLU 94 284 284 GLU GLU A . n A 1 95 SER 95 285 285 SER SER A . n A 1 96 VAL 96 286 286 VAL VAL A . n A 1 97 LYS 97 287 287 LYS LYS A . n A 1 98 GLN 98 288 288 GLN GLN A . n A 1 99 GLY 99 289 ? ? ? A . n A 1 100 VAL 100 290 ? ? ? A . n A 1 101 ASP 101 291 ? ? ? A . n A 1 102 GLN 102 292 ? ? ? A . n A 1 103 ARG 103 293 ? ? ? A . n A 1 104 LEU 104 294 ? ? ? A . n A 1 105 GLY 105 295 ? ? ? A . n A 1 106 GLU 106 296 ? ? ? A . n A 1 107 GLY 107 297 ? ? ? A . n A 1 108 GLN 108 298 ? ? ? A . n A 1 109 GLU 109 299 ? ? ? A . n A 1 110 LYS 110 300 ? ? ? A . n A 1 111 LEU 111 301 ? ? ? A . n A 1 112 HIS 112 302 ? ? ? A . n A 1 113 GLN 113 303 ? ? ? A . n A 1 114 MET 114 304 ? ? ? A . n A 1 115 TRP 115 305 ? ? ? A . n A 1 116 LEU 116 306 ? ? ? A . n A 1 117 SER 117 307 ? ? ? A . n A 1 118 TRP 118 308 ? ? ? A . n A 1 119 ASN 119 309 ? ? ? A . n A 1 120 GLN 120 310 ? ? ? A . n A 1 121 LYS 121 311 ? ? ? A . n A 1 122 THR 122 312 ? ? ? A . n A 1 123 PRO 123 313 ? ? ? A . n A 1 124 GLN 124 314 ? ? ? A . n A 1 125 ASP 125 315 ? ? ? A . n A 1 126 ALA 126 316 ? ? ? A . n A 1 127 GLU 127 317 ? ? ? A . n A 1 128 LYS 128 318 ? ? ? A . n A 1 129 ASP 129 319 ? ? ? A . n A 1 130 PRO 130 320 ? ? ? A . n A 1 131 ALA 131 321 321 ALA ALA A . n A 1 132 LYS 132 322 322 LYS LYS A . n A 1 133 PRO 133 323 323 PRO PRO A . n A 1 134 GLU 134 324 324 GLU GLU A . n A 1 135 GLN 135 325 325 GLN GLN A . n A 1 136 VAL 136 326 326 VAL VAL A . n A 1 137 GLU 137 327 327 GLU GLU A . n A 1 138 ALA 138 328 328 ALA ALA A . n A 1 139 ARG 139 329 329 ARG ARG A . n A 1 140 ALA 140 330 330 ALA ALA A . n A 1 141 LEU 141 331 331 LEU LEU A . n A 1 142 SER 142 332 332 SER SER A . n A 1 143 MET 143 333 333 MET MET A . n A 1 144 PHE 144 334 334 PHE PHE A . n A 1 145 ARG 145 335 335 ARG ARG A . n A 1 146 ASP 146 336 336 ASP ASP A . n A 1 147 ILE 147 337 337 ILE ILE A . n A 1 148 THR 148 338 338 THR THR A . n A 1 149 GLN 149 339 339 GLN GLN A . n A 1 150 GLN 150 340 340 GLN GLN A . n A 1 151 LEU 151 341 341 LEU LEU A . n A 1 152 GLN 152 342 342 GLN GLN A . n A 1 153 SER 153 343 343 SER SER A . n A 1 154 MET 154 344 344 MET MET A . n A 1 155 CYS 155 345 345 CYS CYS A . n A 1 156 VAL 156 346 346 VAL VAL A . n A 1 157 ALA 157 347 347 ALA ALA A . n A 1 158 LEU 158 348 348 LEU LEU A . n A 1 159 GLY 159 349 349 GLY GLY A . n A 1 160 ALA 160 350 350 ALA ALA A . n A 1 161 SER 161 351 351 SER SER A . n A 1 162 ILE 162 352 352 ILE ILE A . n A 1 163 GLN 163 353 353 GLN GLN A . n A 1 164 GLY 164 354 354 GLY GLY A . n A 1 165 LEU 165 355 355 LEU LEU A . n A 1 166 PRO 166 356 356 PRO PRO A . n A 1 167 SER 167 357 357 SER SER A . n A 1 168 HIS 168 358 358 HIS HIS A . n A 1 169 VAL 169 359 359 VAL VAL A . n A 1 170 ARG 170 360 360 ARG ARG A . n A 1 171 GLU 171 361 361 GLU GLU A . n A 1 172 GLN 172 362 362 GLN GLN A . n A 1 173 ALA 173 363 363 ALA ALA A . n A 1 174 GLN 174 364 364 GLN GLN A . n A 1 175 GLN 175 365 365 GLN GLN A . n A 1 176 ALA 176 366 366 ALA ALA A . n A 1 177 ARG 177 367 367 ARG ARG A . n A 1 178 SER 178 368 368 SER SER A . n A 1 179 GLN 179 369 369 GLN GLN A . n A 1 180 VAL 180 370 370 VAL VAL A . n A 1 181 ASN 181 371 371 ASN ASN A . n A 1 182 ASP 182 372 372 ASP ASP A . n A 1 183 LEU 183 373 373 LEU LEU A . n A 1 184 GLN 184 374 374 GLN GLN A . n A 1 185 ALA 185 375 375 ALA ALA A . n A 1 186 THR 186 376 376 THR THR A . n A 1 187 PHE 187 377 377 PHE PHE A . n A 1 188 SER 188 378 378 SER SER A . n A 1 189 GLY 189 379 379 GLY GLY A . n A 1 190 ILE 190 380 380 ILE ILE A . n A 1 191 HIS 191 381 381 HIS HIS A . n A 1 192 SER 192 382 382 SER SER A . n A 1 193 PHE 193 383 383 PHE PHE A . n A 1 194 GLN 194 384 384 GLN GLN A . n A 1 195 ASP 195 385 385 ASP ASP A . n A 1 196 LEU 196 386 386 LEU LEU A . n A 1 197 SER 197 387 387 SER SER A . n A 1 198 ALA 198 388 388 ALA ALA A . n A 1 199 GLY 199 389 389 GLY GLY A . n A 1 200 VAL 200 390 390 VAL VAL A . n A 1 201 LEU 201 391 391 LEU LEU A . n A 1 202 ALA 202 392 392 ALA ALA A . n A 1 203 GLN 203 393 393 GLN GLN A . n A 1 204 THR 204 394 394 THR THR A . n A 1 205 ARG 205 395 395 ARG ARG A . n A 1 206 GLU 206 396 396 GLU GLU A . n A 1 207 ARG 207 397 397 ARG ARG A . n A 1 208 ILE 208 398 398 ILE ILE A . n A 1 209 ALA 209 399 399 ALA ALA A . n A 1 210 ARG 210 400 400 ARG ARG A . n A 1 211 ALA 211 401 401 ALA ALA A . n A 1 212 ARG 212 402 402 ARG ARG A . n A 1 213 GLU 213 403 403 GLU GLU A . n A 1 214 ALA 214 404 404 ALA ALA A . n A 1 215 LEU 215 405 405 LEU LEU A . n A 1 216 ASP 216 406 406 ASP ASP A . n A 1 217 ASN 217 407 407 ASN ASN A . n A 1 218 THR 218 408 408 THR THR A . n A 1 219 VAL 219 409 409 VAL VAL A . n A 1 220 GLU 220 410 410 GLU GLU A . n A 1 221 TYR 221 411 411 TYR TYR A . n A 1 222 VAL 222 412 412 VAL VAL A . n A 1 223 ALA 223 413 413 ALA ALA A . n A 1 224 GLN 224 414 414 GLN GLN A . n A 1 225 ASN 225 415 415 ASN ASN A . n A 1 226 THR 226 416 416 THR THR A . n A 1 227 PRO 227 417 417 PRO PRO A . n A 1 228 ALA 228 418 418 ALA ALA A . n A 1 229 MET 229 419 419 MET MET A . n A 1 230 TRP 230 420 420 TRP TRP A . n A 1 231 LEU 231 421 421 LEU LEU A . n A 1 232 VAL 232 422 422 VAL VAL A . n A 1 233 GLY 233 423 423 GLY GLY A . n A 1 234 PRO 234 424 424 PRO PRO A . n A 1 235 PHE 235 425 425 PHE PHE A . n A 1 236 ALA 236 426 426 ALA ALA A . n A 1 237 PRO 237 427 427 PRO PRO A . n A 1 238 GLY 238 428 428 GLY GLY A . n A 1 239 ILE 239 429 429 ILE ILE A . n A 1 240 THR 240 430 430 THR THR A . n A 1 241 GLU 241 431 431 GLU GLU A . n A 1 242 LYS 242 432 ? ? ? A . n A 1 243 THR 243 433 ? ? ? A . n A 1 244 PRO 244 434 ? ? ? A . n A 1 245 GLU 245 435 ? ? ? A . n A 1 246 GLY 246 436 ? ? ? A . n A 1 247 LYS 247 437 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-07-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 HKL-2000 'data scaling' . ? 2 SOLVE phasing . ? 3 RESOLVE phasing . ? 4 O 'model building' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 209 ? ? -62.13 61.79 2 1 ASP A 224 ? ? -82.64 31.63 3 1 SER A 225 ? ? -32.64 -79.72 4 1 ASP A 226 ? ? 65.22 110.44 5 1 PRO A 417 ? ? -53.49 109.96 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 191 ? A SER 1 2 1 Y 1 A GLY 192 ? A GLY 2 3 1 Y 1 A VAL 193 ? A VAL 3 4 1 Y 1 A ASP 194 ? A ASP 4 5 1 Y 1 A ARG 195 ? A ARG 5 6 1 Y 1 A VAL 196 ? A VAL 6 7 1 Y 1 A LEU 197 ? A LEU 7 8 1 Y 1 A VAL 198 ? A VAL 8 9 1 Y 1 A LYS 199 ? A LYS 9 10 1 Y 1 A SER 200 ? A SER 10 11 1 Y 1 A GLU 201 ? A GLU 11 12 1 Y 1 A ALA 202 ? A ALA 12 13 1 Y 1 A TRP 203 ? A TRP 13 14 1 Y 1 A ALA 204 ? A ALA 14 15 1 Y 1 A ASP 205 ? A ASP 15 16 1 Y 1 A GLY 289 ? A GLY 99 17 1 Y 1 A VAL 290 ? A VAL 100 18 1 Y 1 A ASP 291 ? A ASP 101 19 1 Y 1 A GLN 292 ? A GLN 102 20 1 Y 1 A ARG 293 ? A ARG 103 21 1 Y 1 A LEU 294 ? A LEU 104 22 1 Y 1 A GLY 295 ? A GLY 105 23 1 Y 1 A GLU 296 ? A GLU 106 24 1 Y 1 A GLY 297 ? A GLY 107 25 1 Y 1 A GLN 298 ? A GLN 108 26 1 Y 1 A GLU 299 ? A GLU 109 27 1 Y 1 A LYS 300 ? A LYS 110 28 1 Y 1 A LEU 301 ? A LEU 111 29 1 Y 1 A HIS 302 ? A HIS 112 30 1 Y 1 A GLN 303 ? A GLN 113 31 1 Y 1 A MET 304 ? A MET 114 32 1 Y 1 A TRP 305 ? A TRP 115 33 1 Y 1 A LEU 306 ? A LEU 116 34 1 Y 1 A SER 307 ? A SER 117 35 1 Y 1 A TRP 308 ? A TRP 118 36 1 Y 1 A ASN 309 ? A ASN 119 37 1 Y 1 A GLN 310 ? A GLN 120 38 1 Y 1 A LYS 311 ? A LYS 121 39 1 Y 1 A THR 312 ? A THR 122 40 1 Y 1 A PRO 313 ? A PRO 123 41 1 Y 1 A GLN 314 ? A GLN 124 42 1 Y 1 A ASP 315 ? A ASP 125 43 1 Y 1 A ALA 316 ? A ALA 126 44 1 Y 1 A GLU 317 ? A GLU 127 45 1 Y 1 A LYS 318 ? A LYS 128 46 1 Y 1 A ASP 319 ? A ASP 129 47 1 Y 1 A PRO 320 ? A PRO 130 48 1 Y 1 A LYS 432 ? A LYS 242 49 1 Y 1 A THR 433 ? A THR 243 50 1 Y 1 A PRO 434 ? A PRO 244 51 1 Y 1 A GLU 435 ? A GLU 245 52 1 Y 1 A GLY 436 ? A GLY 246 53 1 Y 1 A LYS 437 ? A LYS 247 #