data_1T0W # _entry.id 1T0W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T0W pdb_00001t0w 10.2210/pdb1t0w/pdb RCSB RCSB022173 ? ? WWPDB D_1000022173 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-09-28 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 5 'Structure model' 2 1 2024-10-30 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' database_PDB_caveat 4 4 'Structure model' entity 5 4 'Structure model' entity_name_com 6 4 'Structure model' pdbx_branch_scheme 7 4 'Structure model' pdbx_chem_comp_identifier 8 4 'Structure model' pdbx_entity_branch 9 4 'Structure model' pdbx_entity_branch_descriptor 10 4 'Structure model' pdbx_entity_branch_link 11 4 'Structure model' pdbx_entity_branch_list 12 4 'Structure model' pdbx_entity_nonpoly 13 4 'Structure model' pdbx_molecule_features 14 4 'Structure model' pdbx_nmr_software 15 4 'Structure model' pdbx_nmr_spectrometer 16 4 'Structure model' pdbx_nonpoly_scheme 17 4 'Structure model' pdbx_struct_assembly_gen 18 4 'Structure model' pdbx_validate_chiral 19 4 'Structure model' struct_asym 20 4 'Structure model' struct_conn 21 4 'Structure model' struct_site 22 4 'Structure model' struct_site_gen 23 5 'Structure model' chem_comp 24 5 'Structure model' chem_comp_atom 25 5 'Structure model' chem_comp_bond 26 5 'Structure model' database_2 27 5 'Structure model' pdbx_entry_details 28 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_asym_id' 2 4 'Structure model' '_atom_site.auth_seq_id' 3 4 'Structure model' '_atom_site.label_asym_id' 4 4 'Structure model' '_chem_comp.name' 5 4 'Structure model' '_chem_comp.type' 6 4 'Structure model' '_entity.formula_weight' 7 4 'Structure model' '_entity.pdbx_description' 8 4 'Structure model' '_entity.pdbx_number_of_molecules' 9 4 'Structure model' '_entity.type' 10 4 'Structure model' '_pdbx_nmr_software.name' 11 4 'Structure model' '_pdbx_nmr_spectrometer.model' 12 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 13 4 'Structure model' '_pdbx_validate_chiral.auth_asym_id' 14 4 'Structure model' '_pdbx_validate_chiral.auth_seq_id' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 17 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 5 'Structure model' '_chem_comp.pdbx_synonyms' 32 5 'Structure model' '_database_2.pdbx_DOI' 33 5 'Structure model' '_database_2.pdbx_database_accession' # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'NAG B 2 HAS WRONG CHIRALITY AT ATOM C1' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T0W _pdbx_database_status.recvd_initial_deposition_date 2004-04-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1HEV 'NMR structure of Hevein (full protein, 43 aa) in the free state' unspecified PDB 1Q9B 'Crystal structure of Hevein (full protein, 43 aa) in the free state' unspecified PDB 1MMC 'NMR structure of AC-AMP2 (Amaranthus Caudatus Antimicrobial Peptide 2) in the free state' unspecified BMRB 10261 'NMR spectral parameters of Hev32 (truncated hevein of 32 aa) complexed with chitotriose' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aboitiz, N.' 1 'Vila-Perello, M.' 2 'Groves, P.' 3 'Asensio, J.L.' 4 'Andreu, D.' 5 'Canada, F.J.' 6 'Jimenez-Barbero, J.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;NMR and modeling studies of protein-carbohydrate interactions: synthesis, three-dimensional structure, and recognition properties of a minimum hevein domain with binding affinity for chitooligosaccharides ; Chembiochem 5 1245 1245 2004 ? GE 1439-4227 ? ? 15368576 10.1002/cbic.200400025 1 ;The interaction of hevein with N-acetylglucosamine-containing oligosaccharides. Solution structure of hevein complexed to chitobiose ; Eur.J.Biochem. 230 621 633 1995 EJBCAI IX 0014-2956 0262 ? ? ? 2 'H NMR study of the solution structure of Ac-AMP2, a sugar binding antimicrobial protein isolated from amaranthus caudatus' J.Mol.Biol. 258 322 333 1996 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1996.0253 3 ;NMR investigations of protein-carbohydrate interactions: refined three-dimensional structure of the complex between hevein and methyl beta-chitobioside ; Glycobiology 8 569 577 1998 ? UK 0959-6658 9999 ? ? 10.1093/glycob/8.6.569 4 ;NMR Investigations of Protein-Carbohydrate Interactions: Studies on the Relevance of Trp/Tyr Variations in Lectin Binding Sites as Deduced from Titration Microcalorimetry and NMR Studies on Hevein Domains. Determination of the NMR Structure of the Complex between Pseudohevein and N'N',N''-triacetylchitotriose ; 'PROTEINS: STRUCT.,FUNCT.,GENET.' 40 218 236 2000 PSFGEY US 0887-3585 0867 ? ? '10.1002/(SICI)1097-0134(20000801)40:2<218::AID-PROT50>3.3.CO;2-G' 5 ;Structural basis for chitin recognition by defense proteins: GlcNAc residues are bound in a multivalent fashion by extended binding sites in hevein domains ; Chem.Biol. 7 529 543 2000 CBOLE2 UK 1074-5521 2050 ? ? '10.1016/S1074-5521(00)00136-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aboitiz, N.' 1 ? primary 'Vila-Perello, M.' 2 ? primary 'Groves, P.' 3 ? primary 'Asensio, J.L.' 4 ? primary 'Andreu, D.' 5 ? primary 'Canada, F.J.' 6 ? primary 'Jimenez-Barbero, J.' 7 ? 1 'Asensio, J.L.' 8 ? 1 'Canada, F.J.' 9 ? 1 'Bruix, M.' 10 ? 1 'Rodriguez-Romero, A.' 11 ? 1 'Jimenez-Barbero, J.' 12 ? 2 'Martins, J.C.' 13 ? 2 'Maes, D.' 14 ? 2 'Loris, R.' 15 ? 2 'Pepermans, H.A.' 16 ? 2 'Wyns, L.' 17 ? 2 'Willem, R.' 18 ? 2 'Verheyden, P.' 19 ? 3 'Asensio, J.L.' 20 ? 3 'Canada, F.J.' 21 ? 3 'Bruix, M.' 22 ? 3 'Gonzalez, C.' 23 ? 3 'Khiar, N.' 24 ? 3 'Rodriguez-Romero, A.' 25 ? 3 'Jimenez-Barbero, J.' 26 ? 4 'Asensio, J.L.' 27 ? 4 'Siebert, H.-C.' 28 ? 4 'von der Lieth, C.-W.' 29 ? 4 'Laynez, J.' 30 ? 4 'Bruix, M.' 31 ? 4 'Soedjanaamadja, U.M.' 32 ? 4 'Beintema, J.J.' 33 ? 4 'Canada, F.J.' 34 ? 4 'Gabius, H.-J.' 35 ? 4 'Jimenez-Barbero, J.' 36 ? 5 'Asensio, J.L.' 37 ? 5 'Canada, F.J.' 38 ? 5 'Siebert, H.-C.' 39 ? 5 'Laynez, J.' 40 ? 5 'Poveda, A.' 41 ? 5 'Nieto, P.M.' 42 ? 5 'Soedjanaamadja, U.M.' 43 ? 5 'Gabius, H.-J.' 44 ? 5 'Jimenez-Barbero, J.' 45 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn Hevein 3484.858 1 ? ? 'N-terminal domain' ? 2 branched man ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; 627.594 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'ALLERGEN HEV B 6' 2 triacetyl-beta-chitotriose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCS(NH2)' _entity_poly.pdbx_seq_one_letter_code_can EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLN n 1 3 CYS n 1 4 GLY n 1 5 ARG n 1 6 GLN n 1 7 ALA n 1 8 GLY n 1 9 GLY n 1 10 LYS n 1 11 LEU n 1 12 CYS n 1 13 PRO n 1 14 ASN n 1 15 ASN n 1 16 LEU n 1 17 CYS n 1 18 CYS n 1 19 SER n 1 20 GLN n 1 21 TRP n 1 22 GLY n 1 23 TRP n 1 24 CYS n 1 25 GLY n 1 26 SER n 1 27 THR n 1 28 ASP n 1 29 GLU n 1 30 TYR n 1 31 CYS n 1 32 SER n 1 33 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;Sequence prepared on a MBHA resin by standard solid phase peptide synthesis protocols. The SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HEVEA BRASILIENSIS (PARA RUBBER TREE). ; # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,3,2/[a2122h-1b_1-5_2*NCC/3=O]/1-1-1/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 NAG C1 O1 2 NAG O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 NH2 33 33 33 NH2 NH2 A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 B NAG 34 n B 2 NAG 2 B NAG 2 B NAG 35 n B 2 NAG 3 B NAG 3 B NAG 36 n # _exptl.entry_id 1T0W _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1T0W _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1T0W _struct.title '25 NMR structures of Truncated Hevein of 32 aa (Hevein-32) complex with N,N,N-triacetylglucosamina' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T0W _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'alpha-helix, anti-parallel beta-sheet, SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HEVE_HEVBR _struct_ref.pdbx_db_accession P02877 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCS _struct_ref.pdbx_align_begin 18 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1T0W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02877 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 49 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 4 ? GLY A 8 ? GLY A 4 GLY A 8 5 ? 5 HELX_P HELX_P2 2 THR A 27 ? SER A 32 ? THR A 27 SER A 32 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 3 A CYS 18 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 12 A CYS 24 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 17 A CYS 31 1_555 ? ? ? ? ? ? ? 2.045 ? ? covale1 covale both ? A SER 32 C ? ? ? 1_555 A NH2 33 N ? ? A SER 32 A NH2 33 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.397 ? ? covale3 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 2 B NAG 3 1_555 ? ? ? ? ? ? ? 1.396 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NH2 A 33 ? SER A 32 ? NH2 A 33 ? 1_555 SER A 32 ? 1_555 . . SER 6 NH2 None 'Terminal amidation' 2 CYS A 3 ? CYS A 18 ? CYS A 3 ? 1_555 CYS A 18 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 12 ? CYS A 24 ? CYS A 12 ? 1_555 CYS A 24 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 17 ? CYS A 31 ? CYS A 17 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1T0W _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 10 O A CYS 31 ? ? HN1 A NH2 33 ? ? 1.44 2 11 O A ASP 28 ? ? HN1 A NH2 33 ? ? 1.55 3 16 O A CYS 31 ? ? HN1 A NH2 33 ? ? 1.52 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.38 120.30 3.08 0.50 N 2 3 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.45 120.30 3.15 0.50 N 3 7 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.95 120.30 4.65 0.50 N 4 8 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.92 120.30 3.62 0.50 N 5 9 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.32 120.30 4.02 0.50 N 6 10 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.56 120.30 3.26 0.50 N 7 13 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.71 120.30 4.41 0.50 N 8 13 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 117.23 120.30 -3.07 0.50 N 9 15 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.60 120.30 4.30 0.50 N 10 16 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.33 120.30 4.03 0.50 N 11 19 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.55 120.30 4.25 0.50 N 12 21 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.87 120.30 4.57 0.50 N 13 22 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.19 120.30 3.89 0.50 N 14 23 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.35 120.30 4.05 0.50 N 15 24 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.78 120.30 3.48 0.50 N 16 25 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.78 120.30 3.48 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 14 ? ? 53.33 -68.28 2 1 ASN A 15 ? ? -162.98 12.94 3 1 SER A 26 ? ? 91.91 2.41 4 2 ALA A 7 ? ? 168.68 -20.53 5 2 ASN A 14 ? ? 64.04 -69.05 6 2 ASN A 15 ? ? -167.44 13.67 7 2 ASP A 28 ? ? -38.61 -74.53 8 2 CYS A 31 ? ? -142.02 -25.46 9 3 GLN A 6 ? ? 58.49 -43.30 10 3 ASN A 14 ? ? 57.77 2.77 11 3 ASN A 15 ? ? 85.25 16.61 12 3 GLN A 20 ? ? -47.46 -17.07 13 3 THR A 27 ? ? -87.74 -154.47 14 3 CYS A 31 ? ? -135.61 -39.71 15 4 ARG A 5 ? ? -84.52 -98.44 16 4 ASN A 14 ? ? 53.42 -71.97 17 4 CYS A 31 ? ? -129.93 -56.30 18 5 ASN A 14 ? ? 52.54 -67.32 19 5 ASN A 15 ? ? -161.19 16.44 20 6 ASN A 14 ? ? 43.38 11.85 21 6 ASN A 15 ? ? 88.17 18.37 22 6 SER A 26 ? ? -70.83 39.49 23 6 CYS A 31 ? ? -132.18 -48.51 24 7 ASN A 14 ? ? 56.77 -84.71 25 7 ASN A 15 ? ? -162.92 24.11 26 7 SER A 26 ? ? -118.19 54.08 27 8 ARG A 5 ? ? -29.01 -69.34 28 8 LYS A 10 ? ? 0.42 108.78 29 8 LEU A 11 ? ? -57.94 175.14 30 8 ASN A 14 ? ? 57.75 -71.74 31 8 ASN A 15 ? ? -154.69 7.66 32 9 LYS A 10 ? ? 26.56 80.92 33 9 ASN A 14 ? ? 50.07 -66.48 34 9 ASN A 15 ? ? -157.59 17.57 35 9 TRP A 21 ? ? -70.86 -70.37 36 10 ASN A 14 ? ? 63.74 -68.85 37 10 ASN A 15 ? ? -175.12 24.23 38 11 GLN A 6 ? ? 63.25 -47.80 39 11 ALA A 7 ? ? -72.57 47.73 40 11 ASN A 14 ? ? 55.20 -68.77 41 11 ASN A 15 ? ? -166.82 17.13 42 12 GLN A 2 ? ? -108.92 -62.05 43 12 ASN A 14 ? ? 50.69 -71.40 44 12 ASN A 15 ? ? -164.97 15.86 45 12 SER A 26 ? ? 80.33 11.78 46 12 ASP A 28 ? ? 1.96 -84.11 47 13 ASN A 14 ? ? 59.20 -74.08 48 13 ASN A 15 ? ? -162.28 16.61 49 13 SER A 19 ? ? -38.17 146.91 50 13 CYS A 31 ? ? -129.80 -81.97 51 14 LYS A 10 ? ? 11.41 84.56 52 14 ASN A 14 ? ? 55.67 -67.30 53 14 ASN A 15 ? ? -162.73 16.54 54 14 ASP A 28 ? ? -30.06 -82.98 55 15 ASN A 14 ? ? 58.54 1.63 56 16 PRO A 13 ? ? -60.03 -178.26 57 17 ASN A 14 ? ? 47.69 -67.06 58 17 ASN A 15 ? ? -162.62 19.78 59 18 ARG A 5 ? ? -89.67 -105.50 60 18 ASN A 14 ? ? 53.93 -67.10 61 18 ASN A 15 ? ? -158.95 15.48 62 19 GLN A 2 ? ? -135.46 -33.94 63 19 ARG A 5 ? ? -45.13 -76.98 64 19 ASN A 14 ? ? 56.98 -70.53 65 19 ASN A 15 ? ? -157.27 9.22 66 20 ASN A 14 ? ? 52.42 -65.88 67 20 ASN A 15 ? ? -159.72 15.36 68 20 SER A 26 ? ? -110.28 55.66 69 20 ASP A 28 ? ? -25.54 -81.46 70 21 ASN A 14 ? ? 54.22 -74.81 71 21 ASN A 15 ? ? -146.61 -0.35 72 21 SER A 26 ? ? 91.57 9.39 73 21 ASP A 28 ? ? -1.33 -84.74 74 22 LEU A 11 ? ? -69.14 -175.53 75 22 ASN A 14 ? ? 53.99 -67.28 76 22 ASN A 15 ? ? -160.73 18.21 77 22 SER A 19 ? ? -67.81 -178.39 78 22 CYS A 31 ? ? -135.14 -54.05 79 23 ASN A 14 ? ? 58.97 -70.56 80 23 ASN A 15 ? ? -158.25 8.59 81 24 ARG A 5 ? ? -43.30 -79.65 82 24 ASN A 14 ? ? 52.43 -67.52 83 24 ASN A 15 ? ? -160.56 18.15 84 25 ARG A 5 ? ? -43.30 -79.65 85 25 ASN A 14 ? ? 52.43 -67.52 86 25 ASN A 15 ? ? -160.56 18.15 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 5 TYR A 30 ? ? CYS A 31 ? ? 146.69 2 6 SER A 26 ? ? THR A 27 ? ? -148.96 3 11 SER A 26 ? ? THR A 27 ? ? -146.87 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 9 _pdbx_validate_chiral.auth_atom_id C1 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id B _pdbx_validate_chiral.auth_comp_id NAG _pdbx_validate_chiral.auth_seq_id 2 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 5 ? ? 0.109 'SIDE CHAIN' 2 2 TYR A 30 ? ? 0.076 'SIDE CHAIN' 3 3 TYR A 30 ? ? 0.084 'SIDE CHAIN' 4 6 ARG A 5 ? ? 0.089 'SIDE CHAIN' 5 7 TYR A 30 ? ? 0.096 'SIDE CHAIN' 6 8 ARG A 5 ? ? 0.150 'SIDE CHAIN' 7 9 TYR A 30 ? ? 0.084 'SIDE CHAIN' 8 11 TYR A 30 ? ? 0.075 'SIDE CHAIN' 9 15 TYR A 30 ? ? 0.068 'SIDE CHAIN' 10 18 TYR A 30 ? ? 0.110 'SIDE CHAIN' 11 20 ARG A 5 ? ? 0.089 'SIDE CHAIN' 12 24 TYR A 30 ? ? 0.073 'SIDE CHAIN' 13 25 TYR A 30 ? ? 0.073 'SIDE CHAIN' # _pdbx_molecule_features.prd_id PRD_900017 _pdbx_molecule_features.name triacetyl-beta-chitotriose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Inhibitor _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900017 _pdbx_molecule.asym_id B # _pdbx_nmr_ensemble.entry_id 1T0W _pdbx_nmr_ensemble.conformers_calculated_total_number 25 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T0W _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM hev32, 3 mM chitotriose, 20 mM phosphate buffer, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D TOCSY' 2 1 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1T0W _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques at tm = 200 and 300 ms' # _pdbx_nmr_refine.entry_id 1T0W _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ;The structures are based on a total of 339 restraints: 321 are NOE-derived distance constraints and 18 come from cys-cys disulfide bridges ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.2 collection ? 1 XEASY 1.3.13 'data analysis' ? 2 DIANA 1.5 'structure solution' ? 3 Amber 5.0 refinement ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 LEU N N N N 137 LEU CA C N S 138 LEU C C N N 139 LEU O O N N 140 LEU CB C N N 141 LEU CG C N N 142 LEU CD1 C N N 143 LEU CD2 C N N 144 LEU OXT O N N 145 LEU H H N N 146 LEU H2 H N N 147 LEU HA H N N 148 LEU HB2 H N N 149 LEU HB3 H N N 150 LEU HG H N N 151 LEU HD11 H N N 152 LEU HD12 H N N 153 LEU HD13 H N N 154 LEU HD21 H N N 155 LEU HD22 H N N 156 LEU HD23 H N N 157 LEU HXT H N N 158 LYS N N N N 159 LYS CA C N S 160 LYS C C N N 161 LYS O O N N 162 LYS CB C N N 163 LYS CG C N N 164 LYS CD C N N 165 LYS CE C N N 166 LYS NZ N N N 167 LYS OXT O N N 168 LYS H H N N 169 LYS H2 H N N 170 LYS HA H N N 171 LYS HB2 H N N 172 LYS HB3 H N N 173 LYS HG2 H N N 174 LYS HG3 H N N 175 LYS HD2 H N N 176 LYS HD3 H N N 177 LYS HE2 H N N 178 LYS HE3 H N N 179 LYS HZ1 H N N 180 LYS HZ2 H N N 181 LYS HZ3 H N N 182 LYS HXT H N N 183 NAG C1 C N R 184 NAG C2 C N R 185 NAG C3 C N R 186 NAG C4 C N S 187 NAG C5 C N R 188 NAG C6 C N N 189 NAG C7 C N N 190 NAG C8 C N N 191 NAG N2 N N N 192 NAG O1 O N N 193 NAG O3 O N N 194 NAG O4 O N N 195 NAG O5 O N N 196 NAG O6 O N N 197 NAG O7 O N N 198 NAG H1 H N N 199 NAG H2 H N N 200 NAG H3 H N N 201 NAG H4 H N N 202 NAG H5 H N N 203 NAG H61 H N N 204 NAG H62 H N N 205 NAG H81 H N N 206 NAG H82 H N N 207 NAG H83 H N N 208 NAG HN2 H N N 209 NAG HO1 H N N 210 NAG HO3 H N N 211 NAG HO4 H N N 212 NAG HO6 H N N 213 NH2 N N N N 214 NH2 HN1 H N N 215 NH2 HN2 H N N 216 PRO N N N N 217 PRO CA C N S 218 PRO C C N N 219 PRO O O N N 220 PRO CB C N N 221 PRO CG C N N 222 PRO CD C N N 223 PRO OXT O N N 224 PRO H H N N 225 PRO HA H N N 226 PRO HB2 H N N 227 PRO HB3 H N N 228 PRO HG2 H N N 229 PRO HG3 H N N 230 PRO HD2 H N N 231 PRO HD3 H N N 232 PRO HXT H N N 233 SER N N N N 234 SER CA C N S 235 SER C C N N 236 SER O O N N 237 SER CB C N N 238 SER OG O N N 239 SER OXT O N N 240 SER H H N N 241 SER H2 H N N 242 SER HA H N N 243 SER HB2 H N N 244 SER HB3 H N N 245 SER HG H N N 246 SER HXT H N N 247 THR N N N N 248 THR CA C N S 249 THR C C N N 250 THR O O N N 251 THR CB C N R 252 THR OG1 O N N 253 THR CG2 C N N 254 THR OXT O N N 255 THR H H N N 256 THR H2 H N N 257 THR HA H N N 258 THR HB H N N 259 THR HG1 H N N 260 THR HG21 H N N 261 THR HG22 H N N 262 THR HG23 H N N 263 THR HXT H N N 264 TRP N N N N 265 TRP CA C N S 266 TRP C C N N 267 TRP O O N N 268 TRP CB C N N 269 TRP CG C Y N 270 TRP CD1 C Y N 271 TRP CD2 C Y N 272 TRP NE1 N Y N 273 TRP CE2 C Y N 274 TRP CE3 C Y N 275 TRP CZ2 C Y N 276 TRP CZ3 C Y N 277 TRP CH2 C Y N 278 TRP OXT O N N 279 TRP H H N N 280 TRP H2 H N N 281 TRP HA H N N 282 TRP HB2 H N N 283 TRP HB3 H N N 284 TRP HD1 H N N 285 TRP HE1 H N N 286 TRP HE3 H N N 287 TRP HZ2 H N N 288 TRP HZ3 H N N 289 TRP HH2 H N N 290 TRP HXT H N N 291 TYR N N N N 292 TYR CA C N S 293 TYR C C N N 294 TYR O O N N 295 TYR CB C N N 296 TYR CG C Y N 297 TYR CD1 C Y N 298 TYR CD2 C Y N 299 TYR CE1 C Y N 300 TYR CE2 C Y N 301 TYR CZ C Y N 302 TYR OH O N N 303 TYR OXT O N N 304 TYR H H N N 305 TYR H2 H N N 306 TYR HA H N N 307 TYR HB2 H N N 308 TYR HB3 H N N 309 TYR HD1 H N N 310 TYR HD2 H N N 311 TYR HE1 H N N 312 TYR HE2 H N N 313 TYR HH H N N 314 TYR HXT H N N 315 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 LEU N CA sing N N 129 LEU N H sing N N 130 LEU N H2 sing N N 131 LEU CA C sing N N 132 LEU CA CB sing N N 133 LEU CA HA sing N N 134 LEU C O doub N N 135 LEU C OXT sing N N 136 LEU CB CG sing N N 137 LEU CB HB2 sing N N 138 LEU CB HB3 sing N N 139 LEU CG CD1 sing N N 140 LEU CG CD2 sing N N 141 LEU CG HG sing N N 142 LEU CD1 HD11 sing N N 143 LEU CD1 HD12 sing N N 144 LEU CD1 HD13 sing N N 145 LEU CD2 HD21 sing N N 146 LEU CD2 HD22 sing N N 147 LEU CD2 HD23 sing N N 148 LEU OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 NAG C1 C2 sing N N 174 NAG C1 O1 sing N N 175 NAG C1 O5 sing N N 176 NAG C1 H1 sing N N 177 NAG C2 C3 sing N N 178 NAG C2 N2 sing N N 179 NAG C2 H2 sing N N 180 NAG C3 C4 sing N N 181 NAG C3 O3 sing N N 182 NAG C3 H3 sing N N 183 NAG C4 C5 sing N N 184 NAG C4 O4 sing N N 185 NAG C4 H4 sing N N 186 NAG C5 C6 sing N N 187 NAG C5 O5 sing N N 188 NAG C5 H5 sing N N 189 NAG C6 O6 sing N N 190 NAG C6 H61 sing N N 191 NAG C6 H62 sing N N 192 NAG C7 C8 sing N N 193 NAG C7 N2 sing N N 194 NAG C7 O7 doub N N 195 NAG C8 H81 sing N N 196 NAG C8 H82 sing N N 197 NAG C8 H83 sing N N 198 NAG N2 HN2 sing N N 199 NAG O1 HO1 sing N N 200 NAG O3 HO3 sing N N 201 NAG O4 HO4 sing N N 202 NAG O6 HO6 sing N N 203 NH2 N HN1 sing N N 204 NH2 N HN2 sing N N 205 PRO N CA sing N N 206 PRO N CD sing N N 207 PRO N H sing N N 208 PRO CA C sing N N 209 PRO CA CB sing N N 210 PRO CA HA sing N N 211 PRO C O doub N N 212 PRO C OXT sing N N 213 PRO CB CG sing N N 214 PRO CB HB2 sing N N 215 PRO CB HB3 sing N N 216 PRO CG CD sing N N 217 PRO CG HG2 sing N N 218 PRO CG HG3 sing N N 219 PRO CD HD2 sing N N 220 PRO CD HD3 sing N N 221 PRO OXT HXT sing N N 222 SER N CA sing N N 223 SER N H sing N N 224 SER N H2 sing N N 225 SER CA C sing N N 226 SER CA CB sing N N 227 SER CA HA sing N N 228 SER C O doub N N 229 SER C OXT sing N N 230 SER CB OG sing N N 231 SER CB HB2 sing N N 232 SER CB HB3 sing N N 233 SER OG HG sing N N 234 SER OXT HXT sing N N 235 THR N CA sing N N 236 THR N H sing N N 237 THR N H2 sing N N 238 THR CA C sing N N 239 THR CA CB sing N N 240 THR CA HA sing N N 241 THR C O doub N N 242 THR C OXT sing N N 243 THR CB OG1 sing N N 244 THR CB CG2 sing N N 245 THR CB HB sing N N 246 THR OG1 HG1 sing N N 247 THR CG2 HG21 sing N N 248 THR CG2 HG22 sing N N 249 THR CG2 HG23 sing N N 250 THR OXT HXT sing N N 251 TRP N CA sing N N 252 TRP N H sing N N 253 TRP N H2 sing N N 254 TRP CA C sing N N 255 TRP CA CB sing N N 256 TRP CA HA sing N N 257 TRP C O doub N N 258 TRP C OXT sing N N 259 TRP CB CG sing N N 260 TRP CB HB2 sing N N 261 TRP CB HB3 sing N N 262 TRP CG CD1 doub Y N 263 TRP CG CD2 sing Y N 264 TRP CD1 NE1 sing Y N 265 TRP CD1 HD1 sing N N 266 TRP CD2 CE2 doub Y N 267 TRP CD2 CE3 sing Y N 268 TRP NE1 CE2 sing Y N 269 TRP NE1 HE1 sing N N 270 TRP CE2 CZ2 sing Y N 271 TRP CE3 CZ3 doub Y N 272 TRP CE3 HE3 sing N N 273 TRP CZ2 CH2 doub Y N 274 TRP CZ2 HZ2 sing N N 275 TRP CZ3 CH2 sing Y N 276 TRP CZ3 HZ3 sing N N 277 TRP CH2 HH2 sing N N 278 TRP OXT HXT sing N N 279 TYR N CA sing N N 280 TYR N H sing N N 281 TYR N H2 sing N N 282 TYR CA C sing N N 283 TYR CA CB sing N N 284 TYR CA HA sing N N 285 TYR C O doub N N 286 TYR C OXT sing N N 287 TYR CB CG sing N N 288 TYR CB HB2 sing N N 289 TYR CB HB3 sing N N 290 TYR CG CD1 doub Y N 291 TYR CG CD2 sing Y N 292 TYR CD1 CE1 sing Y N 293 TYR CD1 HD1 sing N N 294 TYR CD2 CE2 doub Y N 295 TYR CD2 HD2 sing N N 296 TYR CE1 CZ doub Y N 297 TYR CE1 HE1 sing N N 298 TYR CE2 CZ sing Y N 299 TYR CE2 HE2 sing N N 300 TYR CZ OH sing N N 301 TYR OH HH sing N N 302 TYR OXT HXT sing N N 303 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 NAG 3 n # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1T0W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_