data_1T1K # _entry.id 1T1K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T1K pdb_00001t1k 10.2210/pdb1t1k/pdb RCSB RCSB022196 ? ? WWPDB D_1000022196 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LNP 'PARENT MOLECULE OF THIS DEPOSITION, CONTAINS THREE SUBSTITUTIONS' unspecified PDB 1T1P THR-B12-DKP-INSULIN unspecified PDB 1T1Q ABA-B12-DKP-INSULIN unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T1K _pdbx_database_status.recvd_initial_deposition_date 2004-04-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, K.' 1 'Xu, B.' 2 'Hu, S.Q.' 3 'Chu, Y.C.' 4 'Hua, Q.X.' 5 'Whittaker, J.' 6 'Nakagawa, S.H.' 7 'De Meyts, P.' 8 'Katsoyannis, P.G.' 9 'Weiss, M.A.' 10 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'How Insulin Binds: the B-Chain alpha-Helix Contacts the L1 beta-Helix of the Insulin Receptor.' J.Mol.Biol. 341 529 550 2004 JMOBAK UK 0022-2836 0070 ? 15276842 10.1016/j.jmb.2004.05.023 1 'MUTATIONAL ANALYSIS OF INVARIANT VALINE B12 IN INSULIN: IMPLICATION FOR RECEPTOR BINDING' Biochemistry 39 15826 15835 2000 BICHAW US 0006-2960 0033 ? 11123908 10.1021/bi001802+ 2 'ALANINE SCANNING MUTAGENESIS OF INSULIN' J.Biol.Chem. 272 12978 12983 1997 JBCHA3 US 0021-9258 0071 ? ? 10.1074/jbc.272.20.12978 3 'STUDIES ON RECEPTOR BINDING SITE OF INSULIN: THE HYDROPHOBIC B12VAL CAN BE SUBSTITUTED BY HYDROPHILIC THR' BIOCHEM.MOL.BIOL.INT. 39 1245 1254 1996 BMBIES AT 1039-9712 2062 ? 9148904 10.1074/jbc.272.20.12978 4 'STERIC REQUIRMENTS AT POSITION B12 FOR HIGH BIOLOGICAL ACTIVITY IN INSULIN' Biochemistry 32 2631 2635 1993 BICHAW US 0006-2960 0033 ? 8448120 10.1021/bi00061a022 5 '[12-ASPARAGINE-B] HUMAN INSULIN. AN ANALOGUE WITH MODIFICATION IN THE HYDROPHOBIC CORE OF INSULIN' 'INT.J.PEPT.PROTEIN RES.' 17 243 255 1981 IJPPC3 DK 0367-8377 0215 ? 7014485 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, K.' 1 ? primary 'Xu, B.' 2 ? primary 'Hu, S.Q.' 3 ? primary 'Chu, Y.C.' 4 ? primary 'Hua, Q.X.' 5 ? primary 'Qu, Y.' 6 ? primary 'Li, B.' 7 ? primary 'Wang, S.' 8 ? primary 'Wang, R.Y.' 9 ? primary 'Nakagawa, S.H.' 10 ? primary 'Theede, A.M.' 11 ? primary 'Whittaker, J.' 12 ? primary 'De Meyts, P.' 13 ? primary 'Katsoyannis, P.G.' 14 ? primary 'Weiss, M.A.' 15 ? 1 'Nakagawa, S.H.' 16 ? 1 'Tager, H.S.' 17 ? 1 'Steiner, D.F.' 18 ? 2 'Kristen, C.' 19 ? 2 'Kjeldsen, T.' 20 ? 2 'Wiberg, F.C.' 21 ? 2 'Schaffer, L.' 22 ? 2 'Hach, M.' 23 ? 2 'Havelund, S.' 24 ? 2 'Bass, J.' 25 ? 2 'Steiner, D.F.' 26 ? 2 'Andersen, A.S.' 27 ? 3 'Wang, Q.Q.' 28 ? 3 'Feng, Y.M.' 29 ? 3 'Zhang, Y.S.' 30 ? 4 'Hu, S.Q.' 31 ? 4 'Burke, G.T.' 32 ? 4 'Schwartz, G.P.' 33 ? 4 'Ferderigos, N.' 34 ? 4 'Ross, J.B.' 35 ? 4 'Katsoyannis, P.G.' 36 ? 5 'Schwartz, G.P.' 37 ? 5 'Burke, P.G.' 38 ? 5 'Katsoyannis, P.G.' 39 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn Insulin 2383.698 1 ? 'HIS-B10-ASP, VAL-B12-ALA, PRO-B28-LYS, LYS-B29-PRO' 'INSULIN A CHAIN' ? 2 polymer syn Insulin 3382.841 1 ? ? 'INSULIN B CHAIN' ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A ? 2 'polypeptide(L)' no no FVNQHLCGSDLAEALYLVCGERGFFYTKPT FVNQHLCGSDLAEALYLVCGERGFFYTKPT B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 ASP n 2 11 LEU n 2 12 ALA n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 LYS n 2 29 PRO n 2 30 THR n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample ? ? ? ? ? 'THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HOMO SAPIENS(HUMAN)' 2 1 sample ? ? ? ? ? 'THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HOMO SAPIENS(HUMAN)' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP INS_HUMAN 1 GIVEQCCTSICSLYQLENYCN 90 P01308 ? 2 UNP INS_HUMAN 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 P01308 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1T1K A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 1T1K B 1 ? 30 ? P01308 25 ? 54 ? 1 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 1T1K ASP B 10 ? UNP P01308 HIS 34 'engineered mutation' 10 1 2 1T1K ALA B 12 ? UNP P01308 VAL 36 'engineered mutation' 12 2 2 1T1K LYS B 28 ? UNP P01308 PRO 52 'engineered mutation' 28 3 2 1T1K PRO B 29 ? UNP P01308 LYS 53 'engineered mutation' 29 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1,2,3 1,2,3 '2D NOESY' 2 1,2,3 1,2,3 '2D TOCSY' 3 1,2,3 1,2,3 DQF-COSY # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 7.0 null ? K 2 305 ambient 7.6 null ? K 3 298 ambient 1.9 null ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.2 mM Ala-B12-DKP-insulin, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1.2 mM Ala-B12-DKP-insulin, 100% D2O' '100% D2O' 3 '1.2 mM Ala-B12-DKP-insulin, 20% deuterated acetic acid, 80% D2O' '20% deuterated acetic acid, 80% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1T1K _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND SIMULATED ANNEALING' _pdbx_nmr_refine.details ;the structures are based on a total of 668 restraints: 607 are NOE-derived distance constraints, 39 are dihedral angle restraints, 22 are hydrogen bond restraints. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1T1K _pdbx_nmr_details.text 'This structure was determined by using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 1T1K _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T1K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DGII 'INSIGHTII 2000' 'structure solution' 'Molecular Simulations INC.' 1 X-PLOR 3.85 refinement Brunger 2 # _exptl.entry_id 1T1K _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1T1K _struct.title 'NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-ALA, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T1K _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'Ala-B12-DKP-insulin, protein unfolding, insulin receptor, receptor binding, HORMONE-GROWTH FACTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 4 ? SER A 9 ? GLU A 4 SER A 9 1 ? 6 HELX_P HELX_P2 2 SER A 12 ? ASN A 18 ? SER A 12 ASN A 18 1 ? 7 HELX_P HELX_P3 3 CYS B 7 ? CYS B 19 ? CYS B 7 CYS B 19 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.017 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1T1K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1T1K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 ASP 10 10 10 ASP ASP B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 ALA 12 12 12 ALA ALA B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 LYS 28 28 28 LYS LYS B . n B 2 29 PRO 29 29 29 PRO PRO B . n B 2 30 THR 30 30 30 THR THR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-10 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B ALA 12 ? ? H B TYR 16 ? ? 1.52 2 1 O B ASP 10 ? ? H B ALA 14 ? ? 1.53 3 1 O B CYS 19 ? ? H B ARG 22 ? ? 1.57 4 1 O B SER 9 ? ? H B GLU 13 ? ? 1.59 5 2 O B ALA 12 ? ? H B TYR 16 ? ? 1.46 6 3 O B ALA 12 ? ? H B TYR 16 ? ? 1.45 7 4 O B SER 9 ? ? H B GLU 13 ? ? 1.55 8 5 O B ALA 12 ? ? H B TYR 16 ? ? 1.46 9 5 O A GLU 4 ? ? H A THR 8 ? ? 1.51 10 6 O A ILE 2 ? ? H A CYS 6 ? ? 1.50 11 6 O B ALA 12 ? ? H B TYR 16 ? ? 1.56 12 6 O B ASP 10 ? ? H B ALA 14 ? ? 1.57 13 6 O B SER 9 ? ? H B GLU 13 ? ? 1.60 14 7 O B ASP 10 ? ? H B ALA 14 ? ? 1.49 15 7 O A ILE 2 ? ? H A CYS 6 ? ? 1.54 16 7 O B ALA 12 ? ? H B TYR 16 ? ? 1.59 17 8 O B ALA 12 ? ? H B TYR 16 ? ? 1.48 18 8 O A ILE 2 ? ? H A CYS 6 ? ? 1.51 19 8 O B ASP 10 ? ? H B ALA 14 ? ? 1.59 20 9 O B ALA 12 ? ? H B TYR 16 ? ? 1.49 21 9 O B ASP 10 ? ? H B ALA 14 ? ? 1.55 22 10 O B ALA 12 ? ? H B TYR 16 ? ? 1.49 23 11 O B ALA 12 ? ? H B TYR 16 ? ? 1.45 24 11 O B ASP 10 ? ? H B ALA 14 ? ? 1.56 25 11 O B CYS 7 ? ? H B LEU 11 ? ? 1.57 26 12 O B ALA 12 ? ? H B TYR 16 ? ? 1.53 27 12 O B ASP 10 ? ? H B ALA 14 ? ? 1.54 28 13 O B CYS 7 ? ? H B LEU 11 ? ? 1.42 29 13 O B ASP 10 ? ? H B ALA 14 ? ? 1.49 30 13 O B ALA 12 ? ? H B TYR 16 ? ? 1.54 31 13 O A ILE 2 ? ? H A CYS 6 ? ? 1.56 32 13 O B CYS 19 ? ? H B ARG 22 ? ? 1.57 33 13 O A GLU 4 ? ? H A THR 8 ? ? 1.57 34 13 O A LEU 16 ? ? H A TYR 19 ? ? 1.59 35 13 O A LEU 13 ? ? H A GLU 17 ? ? 1.60 36 14 O B ALA 12 ? ? H B TYR 16 ? ? 1.44 37 14 O A ILE 2 ? ? H A CYS 6 ? ? 1.57 38 15 O B ALA 12 ? ? H B TYR 16 ? ? 1.45 39 15 O B ASP 10 ? ? H B ALA 14 ? ? 1.58 40 15 O A ILE 2 ? ? H A CYS 6 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL B 2 ? ? -91.60 -151.43 2 1 THR B 27 ? ? -34.69 160.17 3 2 VAL B 2 ? ? -47.68 -85.16 4 2 GLN B 4 ? ? -100.39 -143.84 5 2 GLU B 21 ? ? 29.20 37.94 6 2 THR B 27 ? ? -33.98 154.23 7 3 VAL B 2 ? ? -95.75 -98.04 8 3 ASN B 3 ? ? -108.45 53.04 9 4 LEU A 13 ? ? -36.47 -36.71 10 4 GLU A 17 ? ? -49.14 -19.34 11 4 ASN B 3 ? ? 177.67 41.29 12 4 GLN B 4 ? ? -100.63 -169.83 13 4 THR B 27 ? ? -96.17 -156.96 14 5 LEU A 13 ? ? -36.02 -38.01 15 5 GLN B 4 ? ? -100.42 -144.81 16 5 LYS B 28 ? ? -164.12 72.58 17 6 VAL B 2 ? ? -91.11 -65.15 18 6 ASN B 3 ? ? -173.15 51.27 19 6 GLN B 4 ? ? -101.56 -169.65 20 6 GLU B 21 ? ? 37.28 28.80 21 6 THR B 27 ? ? -59.97 -156.69 22 7 VAL B 2 ? ? -62.08 -179.63 23 7 ASN B 3 ? ? -65.30 73.01 24 7 LYS B 28 ? ? 62.27 101.32 25 8 LEU A 13 ? ? -34.36 -35.04 26 8 TYR A 19 ? ? -141.11 43.99 27 8 VAL B 2 ? ? -59.31 -166.89 28 8 ASN B 3 ? ? -97.55 50.60 29 8 GLN B 4 ? ? -101.05 -168.56 30 8 SER B 9 ? ? -38.45 -73.46 31 8 CYS B 19 ? ? -98.30 -62.85 32 8 GLU B 21 ? ? 39.66 28.47 33 8 THR B 27 ? ? -41.87 171.75 34 8 LYS B 28 ? ? 73.18 70.47 35 9 LEU A 13 ? ? -34.54 -33.19 36 9 ASN B 3 ? ? 177.67 35.33 37 9 SER B 9 ? ? -37.30 -71.81 38 9 THR B 27 ? ? -82.10 -152.95 39 9 LYS B 28 ? ? -39.95 124.86 40 10 TYR A 19 ? ? -140.28 38.66 41 10 ASN B 3 ? ? -158.28 49.48 42 10 GLN B 4 ? ? -100.94 -164.35 43 10 LYS B 28 ? ? -164.85 83.67 44 11 VAL B 2 ? ? -75.07 -155.66 45 11 ASN B 3 ? ? -174.32 55.01 46 11 GLN B 4 ? ? -100.23 -151.92 47 11 SER B 9 ? ? -39.28 -71.87 48 11 GLU B 21 ? ? 38.07 22.92 49 11 THR B 27 ? ? -27.62 147.99 50 12 VAL B 2 ? ? -46.21 -91.33 51 12 ASN B 3 ? ? -118.39 77.17 52 12 GLN B 4 ? ? -101.20 -159.31 53 12 LYS B 28 ? ? -151.10 69.99 54 13 CYS A 11 ? ? -172.87 127.79 55 13 ASN B 3 ? ? -64.59 68.47 56 13 THR B 27 ? ? -29.55 -37.33 57 13 LYS B 28 ? ? 16.31 100.16 58 14 ASN B 3 ? ? 48.56 70.27 59 14 LYS B 28 ? ? 177.09 79.32 60 15 TYR A 19 ? ? -140.92 44.49 61 15 VAL B 2 ? ? -59.53 -175.73 62 15 SER B 9 ? ? -42.00 -70.78 63 15 THR B 27 ? ? -34.10 155.23 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG B 22 ? ? 0.288 'SIDE CHAIN' 2 2 ARG B 22 ? ? 0.305 'SIDE CHAIN' 3 3 ARG B 22 ? ? 0.317 'SIDE CHAIN' 4 4 ARG B 22 ? ? 0.285 'SIDE CHAIN' 5 5 ARG B 22 ? ? 0.220 'SIDE CHAIN' 6 6 ARG B 22 ? ? 0.214 'SIDE CHAIN' 7 7 ARG B 22 ? ? 0.224 'SIDE CHAIN' 8 8 ARG B 22 ? ? 0.255 'SIDE CHAIN' 9 9 ARG B 22 ? ? 0.151 'SIDE CHAIN' 10 10 ARG B 22 ? ? 0.304 'SIDE CHAIN' 11 11 ARG B 22 ? ? 0.297 'SIDE CHAIN' 12 12 ARG B 22 ? ? 0.315 'SIDE CHAIN' 13 13 ARG B 22 ? ? 0.204 'SIDE CHAIN' 14 14 ARG B 22 ? ? 0.228 'SIDE CHAIN' 15 15 ARG B 22 ? ? 0.191 'SIDE CHAIN' #