data_1T1Q # _entry.id 1T1Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T1Q pdb_00001t1q 10.2210/pdb1t1q/pdb RCSB RCSB022201 ? ? WWPDB D_1000022201 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LNP 'PARENT MOLECULE OF THIS DEPOSITION, CONTAINS THREE SUBSTITUTIONS' unspecified PDB 1T1K ALA-B12-DKP-INSULIN unspecified PDB 1T1P THR-B12-DKP-INSULIN unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T1Q _pdbx_database_status.recvd_initial_deposition_date 2004-04-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, K.' 1 'Xu, B.' 2 'Hu, S.Q.' 3 'Chu, Y.C.' 4 'Hua, Q.X.' 5 'Whittaker, J.' 6 'Nakagawa, S.H.' 7 'De Meyts, P.' 8 'Katsoyannis, P.G.' 9 'Weiss, M.A.' 10 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'How Insulin Binds: the B-Chain alpha-Helix Contacts the L1 beta-Helix of the Insulin Receptor.' J.Mol.Biol. 341 529 550 2004 JMOBAK UK 0022-2836 0070 ? 15276842 10.1016/j.jmb.2004.05.023 1 'MUTATIONAL ANALYSIS OF INVARIANT VALINE B12 IN INSULIN: IMPLICATION FOR RECEPTOR BINDING' Biochemistry 39 15826 15835 2000 BICHAW US 0006-2960 0033 ? 11123908 10.1021/bi001802+ 2 'ALANINE SCANNING MUTAGENESIS OF INSULIN' J.Biol.Chem. 272 12978 12983 1997 JBCHA3 US 0021-9258 0071 ? 9148904 10.1074/jbc.272.20.12978 3 'STUDIES ON RECEPTOR BINDING SITE OF INSULIN: THE HYDROPHOBIC B12VALCAN BE SUBSTITUTED BY HYDROPHILIC THR' BIOCHEM.MOL.BIOL.INT. 39 1245 1254 1996 BMBIES AT 1039-9712 2062 ? 8876979 ? 4 'STERIC REQUIRMENTS AT POSITION B12 FOR HIGH BIOLOGICAL ACTIVITY IN INSULIN' Biochemistry 32 2631 2635 1993 BICHAW US 0006-2960 0033 ? 8448120 ? 5 '[12-ASPARAGINE-B] HUMAN INSULIN. AN ANALOGUE WITH MODIFICATION IN THEHYDROPHOBIC CORE OF INSULIN' 'INT.J.PEPT.PROTEIN RES.' 17 243 255 1981 IJPPC3 DK 0367-8377 0215 ? 7014485 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, K.' 1 ? primary 'Xu, B.' 2 ? primary 'Hu, S.Q.' 3 ? primary 'Chu, Y.C.' 4 ? primary 'Hua, Q.X.' 5 ? primary 'Qu, Y.' 6 ? primary 'Li, B.' 7 ? primary 'Wang, S.' 8 ? primary 'Wang, R.Y.' 9 ? primary 'Nakagawa, S.H.' 10 ? primary 'Theede, A.M.' 11 ? primary 'Whittaker, J.' 12 ? primary 'De Meyts, P.' 13 ? primary 'Katsoyannis, P.G.' 14 ? primary 'Weiss, M.A.' 15 ? 1 'Nakagawa, S.H.' 16 ? 1 'Tager, H.S.' 17 ? 1 'Steiner, D.F.' 18 ? 2 'Kristen, C.' 19 ? 2 'Kjeldsen, T.' 20 ? 2 'Wiberg, F.C.' 21 ? 2 'Schaffer, L.' 22 ? 2 'Hach, M.' 23 ? 2 'Havelund, S.' 24 ? 2 'Bass, J.' 25 ? 2 'Steiner, D.F.' 26 ? 2 'Andersen, A.S.' 27 ? 3 'Wang, Q.Q.' 28 ? 3 'Feng, Y.M.' 29 ? 3 'Zhang, Y.S.' 30 ? 4 'Hu, S.Q.' 31 ? 4 'Burke, G.T.' 32 ? 4 'Schwartz, G.P.' 33 ? 4 'Ferderigos, N.' 34 ? 4 'Ross, J.B.' 35 ? 4 'Katsoyannis, P.G.' 36 ? 5 'Schwartz, G.P.' 37 ? 5 'Burke, P.G.' 38 ? 5 'Katsoyannis, P.G.' 39 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn insulin 2383.698 1 ? 'HIS-B10-ASP, VAL-B12-ABA, PRO-B28-LYS, LYS-B29-PRO' 'INSULIN A CHAIN' ? 2 polymer syn Insulin 3396.868 1 ? ? 'INSULIN B CHAIN' ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A ? 2 'polypeptide(L)' no yes 'FVNQHLCGSDL(ABA)EALYLVCGERGFFYTKPT' FVNQHLCGSDLAEALYLVCGERGFFYTKPT B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 ASP n 2 11 LEU n 2 12 ABA n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 LYS n 2 29 PRO n 2 30 THR n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample ? ? ? ? ? 'THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HOMO SAPIENS(HUMAN)' 2 1 sample ? ? ? ? ? 'THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HOMO SAPIENS(HUMAN)' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP INS_HUMAN 1 GIVEQCCTSICSLYQLENYCN 1 P01308 ? 2 UNP INS_HUMAN 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 P01308 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1T1Q A 1 ? 21 ? P01308 1 ? 21 ? 1 21 2 2 1T1Q B 1 ? 30 ? P01308 25 ? 54 ? 1 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 1T1Q ASP B 10 ? UNP P01308 HIS 34 'engineered mutation' 10 1 2 1T1Q ABA B 12 ? UNP P01308 VAL 36 'engineered mutation' 12 2 2 1T1Q LYS B 28 ? UNP P01308 PRO 52 'engineered mutation' 28 3 2 1T1Q PRO B 29 ? UNP P01308 LYS 53 'engineered mutation' 29 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1,2,3 1,2,3 '2D NOESY' 2 1,2,3 1,2,3 '2D TOCSY' 3 1,2,3 1,2,3 DQF-COSY # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 7.0 ? ? K 2 305 ambient 7.6 ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.2 mM ABA-B12-DKP-insulin, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1.2 mM ABA-B12-DKP-insulin,100% D2O' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1T1Q _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND SIMULATED ANNEALING' _pdbx_nmr_refine.details ;the structures are based on a total of 590 restraints: 527 are NOE-derived distance constraints, 39 are dihedral angle restraints, 24 are hydrogen bond restraints. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1T1Q _pdbx_nmr_details.text 'This structure was determined by using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 1T1Q _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T1Q _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DGII 'INSIGHTII 2000' 'structure solution' 'Molecular Simulations INC.' 1 X-PLOR 3.85 refinement Brunger 2 # _exptl.entry_id 1T1Q _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1T1Q _struct.title 'NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-ABA, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T1Q _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'Aba-B12-DKP-insulin, protein unfolding, insulin receptor, receptor binding, HORMONE-GROWTH FACTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? GLU A 17 ? SER A 12 GLU A 17 1 ? 6 HELX_P HELX_P2 2 CYS B 7 ? CYS B 19 ? CYS B 7 CYS B 19 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.013 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.019 ? ? covale1 covale both ? B LEU 11 C ? ? ? 1_555 B ABA 12 N ? ? B LEU 11 B ABA 12 1_555 ? ? ? ? ? ? ? 1.303 ? ? covale2 covale both ? B ABA 12 C ? ? ? 1_555 B GLU 13 N ? ? B ABA 12 B GLU 13 1_555 ? ? ? ? ? ? ? 1.309 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _database_PDB_matrix.entry_id 1T1Q _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1T1Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 ASP 10 10 10 ASP ASP B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 ABA 12 12 12 ABA ABA B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 LYS 28 28 28 LYS LYS B . n B 2 29 PRO 29 29 29 PRO PRO B . n B 2 30 THR 30 30 30 THR THR B . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id ABA _pdbx_struct_mod_residue.label_seq_id 12 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id ABA _pdbx_struct_mod_residue.auth_seq_id 12 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ALA _pdbx_struct_mod_residue.details 'ALPHA-AMINOBUTYRIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-10 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-03-28 5 'Structure model' 1 4 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' struct_conn 3 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ASN 21 ? ? O B GLY 23 ? ? 1.48 2 1 O B GLY 8 ? ? H B LEU 11 ? ? 1.49 3 1 O B GLU 13 ? ? H B LEU 17 ? ? 1.50 4 2 H A ASN 21 ? ? O B GLY 23 ? ? 1.46 5 2 O B GLY 8 ? ? H B LEU 11 ? ? 1.47 6 2 O B CYS 19 ? ? H B GLU 21 ? ? 1.58 7 3 H A ASN 21 ? ? O B GLY 23 ? ? 1.44 8 3 O B GLU 13 ? ? H B LEU 17 ? ? 1.52 9 4 H A ASN 21 ? ? O B GLY 23 ? ? 1.49 10 4 O A GLN 5 ? ? H A SER 9 ? ? 1.56 11 4 O B GLU 13 ? ? H B LEU 17 ? ? 1.59 12 5 O A SER 12 ? ? H A GLN 15 ? ? 1.58 13 6 H A ASN 21 ? ? O B GLY 23 ? ? 1.47 14 6 O B ALA 14 ? ? H B VAL 18 ? ? 1.51 15 6 O B GLU 13 ? ? H B LEU 17 ? ? 1.59 16 7 H A ASN 21 ? ? O B GLY 23 ? ? 1.48 17 7 O B GLU 13 ? ? H B LEU 17 ? ? 1.50 18 7 O B GLY 8 ? ? H B LEU 11 ? ? 1.56 19 8 O B GLY 8 ? ? H B LEU 11 ? ? 1.45 20 8 H A ASN 21 ? ? O B GLY 23 ? ? 1.47 21 8 O B GLU 13 ? ? H B LEU 17 ? ? 1.51 22 9 H A ASN 21 ? ? O B GLY 23 ? ? 1.51 23 9 O B GLY 20 ? ? H B GLY 23 ? ? 1.52 24 9 O B GLU 13 ? ? H B LEU 17 ? ? 1.53 25 9 O B GLY 8 ? ? H B LEU 11 ? ? 1.54 26 10 O B GLY 8 ? ? H B LEU 11 ? ? 1.48 27 10 H A ASN 21 ? ? O B GLY 23 ? ? 1.49 28 10 O B GLU 13 ? ? H B LEU 17 ? ? 1.55 29 11 H A ASN 21 ? ? O B GLY 23 ? ? 1.47 30 11 O B ALA 14 ? ? H B VAL 18 ? ? 1.57 31 12 O B GLY 8 ? ? H B LEU 11 ? ? 1.56 32 12 O B GLU 13 ? ? H B LEU 17 ? ? 1.56 33 13 H A ASN 21 ? ? O B GLY 23 ? ? 1.47 34 13 O B GLY 8 ? ? H B LEU 11 ? ? 1.47 35 13 O B GLU 13 ? ? H B LEU 17 ? ? 1.48 36 13 O B CYS 19 ? ? H B GLU 21 ? ? 1.56 37 13 O A SER 12 ? ? H A GLN 15 ? ? 1.58 38 14 H A ASN 21 ? ? O B GLY 23 ? ? 1.48 39 14 O B GLU 13 ? ? H B LEU 17 ? ? 1.53 40 15 H A ASN 21 ? ? O B GLY 23 ? ? 1.47 41 15 O B GLY 8 ? ? H B LEU 11 ? ? 1.51 42 15 O B GLU 13 ? ? H B LEU 17 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 13 ? ? -38.53 -28.43 2 1 CYS B 19 ? ? -116.03 -78.95 3 1 LYS B 28 ? ? 61.48 116.73 4 1 PRO B 29 ? ? -77.42 -77.53 5 2 LEU A 13 ? ? -28.80 -40.06 6 2 VAL B 2 ? ? -86.11 -112.13 7 2 CYS B 7 ? ? -120.35 -80.64 8 2 CYS B 19 ? ? -116.97 -77.94 9 2 LYS B 28 ? ? 170.66 79.71 10 3 GLN A 5 ? ? -102.86 -87.37 11 3 THR A 8 ? ? -89.79 30.08 12 3 SER A 9 ? ? 164.35 -167.62 13 3 VAL B 2 ? ? -97.39 50.88 14 3 ASN B 3 ? ? -50.21 84.05 15 3 CYS B 19 ? ? -94.52 -61.10 16 3 GLU B 21 ? ? -65.40 87.77 17 3 ARG B 22 ? ? 174.62 -35.39 18 3 LYS B 28 ? ? -163.84 89.37 19 4 GLN A 5 ? ? -101.07 -102.74 20 4 SER A 9 ? ? -120.26 -157.82 21 4 LEU A 13 ? ? -23.60 -56.97 22 4 ASN B 3 ? ? 40.53 24.40 23 4 CYS B 19 ? ? -108.45 -73.91 24 5 LEU A 13 ? ? -27.04 -44.92 25 5 ASN B 3 ? ? 39.52 47.12 26 5 CYS B 19 ? ? -131.63 -58.62 27 5 PHE B 24 ? ? -171.46 124.08 28 6 GLN A 5 ? ? -95.53 -75.94 29 6 SER A 9 ? ? -146.15 -156.50 30 6 VAL B 2 ? ? -100.25 -88.85 31 6 ASN B 3 ? ? -111.01 53.40 32 6 LEU B 6 ? ? -177.36 115.43 33 6 GLU B 13 ? ? -91.73 -60.93 34 6 CYS B 19 ? ? -130.78 -73.95 35 7 VAL A 3 ? ? -49.91 -16.99 36 7 GLN A 5 ? ? -99.84 -76.63 37 7 SER A 9 ? ? -118.89 -167.61 38 7 VAL B 2 ? ? -60.26 -103.50 39 7 LEU B 6 ? ? -119.06 -163.37 40 7 CYS B 7 ? ? -165.90 -86.68 41 7 CYS B 19 ? ? -128.47 -75.75 42 7 LYS B 28 ? ? -178.27 97.55 43 7 PRO B 29 ? ? -78.49 -160.79 44 8 GLN A 5 ? ? -97.16 -65.21 45 8 CYS A 7 ? ? -76.60 -85.36 46 8 SER A 9 ? ? -128.27 -167.88 47 8 LEU A 13 ? ? -39.23 -27.43 48 8 VAL B 2 ? ? -100.36 53.21 49 8 ASN B 3 ? ? -53.22 92.16 50 8 CYS B 7 ? ? -117.55 -98.51 51 8 CYS B 19 ? ? -130.31 -76.62 52 8 TYR B 26 ? ? -114.09 72.86 53 8 LYS B 28 ? ? -154.21 52.31 54 9 CYS A 7 ? ? -93.65 -61.98 55 9 CYS B 7 ? ? -126.62 -88.86 56 9 CYS B 19 ? ? -112.86 -77.53 57 9 PRO B 29 ? ? -78.39 -167.12 58 10 THR A 8 ? ? -68.19 -73.40 59 10 LEU A 13 ? ? -30.70 -34.73 60 10 ASN B 3 ? ? -26.99 87.75 61 10 CYS B 7 ? ? -119.28 -79.69 62 10 CYS B 19 ? ? -107.72 -75.76 63 10 PHE B 25 ? ? -100.41 -89.62 64 10 TYR B 26 ? ? 99.90 73.44 65 10 LYS B 28 ? ? 177.51 106.88 66 11 SER A 9 ? ? -109.79 -159.03 67 11 VAL B 2 ? ? -43.81 96.04 68 11 ASN B 3 ? ? -95.47 49.90 69 11 LEU B 6 ? ? -172.68 99.86 70 11 CYS B 19 ? ? -111.35 -76.40 71 11 LYS B 28 ? ? -163.08 60.62 72 12 GLN A 5 ? ? -101.14 -65.75 73 12 LEU A 13 ? ? -37.66 -28.99 74 12 ASN B 3 ? ? -47.19 94.70 75 12 VAL B 18 ? ? -102.33 -62.05 76 12 PHE B 25 ? ? -100.77 -90.41 77 12 TYR B 26 ? ? 103.73 84.97 78 12 THR B 27 ? ? -60.41 -179.23 79 13 GLN A 5 ? ? -105.94 -79.56 80 13 SER A 9 ? ? -107.22 -163.73 81 13 LEU A 13 ? ? -37.07 -28.44 82 13 CYS B 7 ? ? -114.07 -84.96 83 13 CYS B 19 ? ? -111.30 -75.62 84 13 LYS B 28 ? ? -173.75 74.61 85 14 GLN A 5 ? ? -103.30 -75.80 86 14 SER A 9 ? ? -121.08 -164.03 87 14 LEU A 13 ? ? -32.86 -32.34 88 14 ASN B 3 ? ? 58.82 17.59 89 14 CYS B 19 ? ? -129.21 -72.71 90 14 LYS B 28 ? ? 74.94 69.39 91 15 ASN B 3 ? ? -56.04 83.39 92 15 CYS B 7 ? ? -130.17 -83.66 93 15 CYS B 19 ? ? -112.17 -78.24 94 15 PHE B 25 ? ? -100.47 -81.77 95 15 TYR B 26 ? ? 89.67 92.84 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG B 22 ? ? 0.312 'SIDE CHAIN' 2 2 ARG B 22 ? ? 0.213 'SIDE CHAIN' 3 4 ARG B 22 ? ? 0.272 'SIDE CHAIN' 4 5 ARG B 22 ? ? 0.314 'SIDE CHAIN' 5 6 ARG B 22 ? ? 0.295 'SIDE CHAIN' 6 7 ARG B 22 ? ? 0.236 'SIDE CHAIN' 7 8 ARG B 22 ? ? 0.206 'SIDE CHAIN' 8 9 ARG B 22 ? ? 0.296 'SIDE CHAIN' 9 10 ARG B 22 ? ? 0.239 'SIDE CHAIN' 10 11 ARG B 22 ? ? 0.312 'SIDE CHAIN' 11 12 ARG B 22 ? ? 0.311 'SIDE CHAIN' 12 13 ARG B 22 ? ? 0.141 'SIDE CHAIN' 13 14 ARG B 22 ? ? 0.174 'SIDE CHAIN' 14 15 ARG B 22 ? ? 0.237 'SIDE CHAIN' #