data_1T2M # _entry.id 1T2M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T2M pdb_00001t2m 10.2210/pdb1t2m/pdb RCSB RCSB022233 ? ? WWPDB D_1000022233 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-08 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T2M _pdbx_database_status.recvd_initial_deposition_date 2004-04-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhou, H.' 1 'Wu, J.H.' 2 'Xu, Y.Q.' 3 'Huang, A.D.' 4 'Shi, Y.Y.' 5 # _citation.id primary _citation.title 'Solution Structure of AF-6 PDZ Domain and Its Interaction with the C-terminal Peptides from Neurexin and Bcr' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 13841 _citation.page_last 13847 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15684424 _citation.pdbx_database_id_DOI 10.1074/jbc.M411065200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhou, H.' 1 ? primary 'Xu, Y.' 2 ? primary 'Yang, Y.' 3 ? primary 'Huang, A.' 4 ? primary 'Wu, J.' 5 ? primary 'Shi, Y.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'AF-6 protein' _entity.formula_weight 10637.198 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Pdz domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRT SSVVTLEVAKQGALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRT SSVVTLEVAKQGALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 PRO n 1 5 GLU n 1 6 ILE n 1 7 ILE n 1 8 THR n 1 9 VAL n 1 10 THR n 1 11 LEU n 1 12 LYS n 1 13 LYS n 1 14 GLN n 1 15 ASN n 1 16 GLY n 1 17 MET n 1 18 GLY n 1 19 LEU n 1 20 SER n 1 21 ILE n 1 22 VAL n 1 23 ALA n 1 24 ALA n 1 25 LYS n 1 26 GLY n 1 27 ALA n 1 28 GLY n 1 29 GLN n 1 30 ASP n 1 31 LYS n 1 32 LEU n 1 33 GLY n 1 34 ILE n 1 35 TYR n 1 36 VAL n 1 37 LYS n 1 38 SER n 1 39 VAL n 1 40 VAL n 1 41 LYS n 1 42 GLY n 1 43 GLY n 1 44 ALA n 1 45 ALA n 1 46 ASP n 1 47 VAL n 1 48 ASP n 1 49 GLY n 1 50 ARG n 1 51 LEU n 1 52 ALA n 1 53 ALA n 1 54 GLY n 1 55 ASP n 1 56 GLN n 1 57 LEU n 1 58 LEU n 1 59 SER n 1 60 VAL n 1 61 ASP n 1 62 GLY n 1 63 ARG n 1 64 SER n 1 65 LEU n 1 66 VAL n 1 67 GLY n 1 68 LEU n 1 69 SER n 1 70 GLN n 1 71 GLU n 1 72 ARG n 1 73 ALA n 1 74 ALA n 1 75 GLU n 1 76 LEU n 1 77 MET n 1 78 THR n 1 79 ARG n 1 80 THR n 1 81 SER n 1 82 SER n 1 83 VAL n 1 84 VAL n 1 85 THR n 1 86 LEU n 1 87 GLU n 1 88 VAL n 1 89 ALA n 1 90 LYS n 1 91 GLN n 1 92 GLY n 1 93 ALA n 1 94 LEU n 1 95 GLU n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue brain _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 ? ? ? A . n A 1 95 GLU 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n # _exptl.entry_id 1T2M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1T2M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1T2M _struct.title 'Solution Structure Of The Pdz Domain Of AF-6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T2M _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Chromosomal translocation, Proto-oncogene, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AFAD_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTS SVVTLEVAKQGA ; _struct_ref.pdbx_align_begin 987 _struct_ref.pdbx_db_accession P55196 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1T2M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55196 _struct_ref_seq.db_align_beg 987 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1077 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1T2M MET A 1 ? UNP P55196 ? ? 'initiating methionine' 1 1 1 1T2M LEU A 94 ? UNP P55196 ? ? 'expression tag' 94 2 1 1T2M GLU A 95 ? UNP P55196 ? ? 'expression tag' 95 3 1 1T2M HIS A 96 ? UNP P55196 ? ? 'expression tag' 96 4 1 1T2M HIS A 97 ? UNP P55196 ? ? 'expression tag' 97 5 1 1T2M HIS A 98 ? UNP P55196 ? ? 'expression tag' 98 6 1 1T2M HIS A 99 ? UNP P55196 ? ? 'expression tag' 99 7 1 1T2M HIS A 100 ? UNP P55196 ? ? 'expression tag' 100 8 1 1T2M HIS A 101 ? UNP P55196 ? ? 'expression tag' 101 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 43 ? GLY A 49 ? GLY A 43 GLY A 49 1 ? 7 HELX_P HELX_P2 2 SER A 69 ? ARG A 79 ? SER A 69 ARG A 79 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 5 ? LYS A 12 ? GLU A 5 LYS A 12 A 2 VAL A 83 ? LYS A 90 ? VAL A 83 LYS A 90 A 3 ASP A 55 ? VAL A 60 ? ASP A 55 VAL A 60 A 4 GLY A 33 ? VAL A 39 ? GLY A 33 VAL A 39 A 5 LEU A 19 ? ALA A 24 ? LEU A 19 ALA A 24 B 1 GLU A 5 ? LYS A 12 ? GLU A 5 LYS A 12 B 2 VAL A 83 ? LYS A 90 ? VAL A 83 LYS A 90 B 3 ASP A 55 ? VAL A 60 ? ASP A 55 VAL A 60 B 4 ARG A 63 ? SER A 64 ? ARG A 63 SER A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 11 ? N LEU A 11 O VAL A 84 ? O VAL A 84 A 2 3 O ALA A 89 ? O ALA A 89 N GLN A 56 ? N GLN A 56 A 3 4 O ASP A 55 ? O ASP A 55 N VAL A 36 ? N VAL A 36 A 4 5 O TYR A 35 ? O TYR A 35 N VAL A 22 ? N VAL A 22 B 1 2 N LEU A 11 ? N LEU A 11 O VAL A 84 ? O VAL A 84 B 2 3 O ALA A 89 ? O ALA A 89 N GLN A 56 ? N GLN A 56 B 3 4 N VAL A 60 ? N VAL A 60 O ARG A 63 ? O ARG A 63 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 15 ? ? -163.40 47.08 2 1 LYS A 31 ? ? -122.10 -158.81 3 1 ARG A 50 ? ? -106.26 -67.82 4 1 LEU A 58 ? ? -109.07 -62.71 5 1 LEU A 65 ? ? -96.86 51.19 6 2 PRO A 4 ? ? -69.86 -166.20 7 2 ASN A 15 ? ? -152.87 32.26 8 2 LYS A 31 ? ? -123.66 -147.44 9 2 LEU A 58 ? ? -108.25 -63.12 10 2 ARG A 79 ? ? -95.35 56.81 11 2 GLN A 91 ? ? -101.28 -165.78 12 3 LYS A 2 ? ? 64.00 96.58 13 3 GLU A 3 ? ? 59.11 78.82 14 3 GLN A 14 ? ? -92.82 56.80 15 3 MET A 17 ? ? -138.71 -68.34 16 3 LYS A 31 ? ? -121.47 -155.43 17 3 ARG A 79 ? ? -92.71 44.30 18 3 LYS A 90 ? ? -66.45 87.95 19 3 GLN A 91 ? ? -110.55 -168.16 20 4 LYS A 2 ? ? 64.27 75.42 21 4 GLU A 3 ? ? 68.45 146.29 22 4 GLN A 14 ? ? -101.04 68.69 23 4 ARG A 79 ? ? -101.72 65.10 24 4 LYS A 90 ? ? -66.83 83.57 25 4 GLN A 91 ? ? -108.02 -168.49 26 5 GLU A 3 ? ? 61.94 98.05 27 5 PRO A 4 ? ? -59.93 -178.19 28 5 MET A 17 ? ? -127.32 -59.11 29 5 LYS A 31 ? ? -124.01 -151.54 30 5 LYS A 90 ? ? -66.20 83.97 31 6 GLN A 14 ? ? -115.06 73.16 32 6 MET A 17 ? ? -100.72 -65.21 33 6 LEU A 58 ? ? -145.18 -54.76 34 6 LYS A 90 ? ? -66.28 91.56 35 6 GLN A 91 ? ? -113.07 -165.87 36 7 ASN A 15 ? ? -160.32 42.54 37 7 ASP A 30 ? ? -95.22 37.26 38 7 LYS A 31 ? ? -140.21 -148.50 39 7 LYS A 41 ? ? -59.58 109.01 40 7 ARG A 50 ? ? -144.10 -51.39 41 7 LEU A 58 ? ? -95.18 -63.63 42 7 ARG A 79 ? ? -91.21 58.02 43 8 ASN A 15 ? ? -164.91 38.57 44 8 MET A 17 ? ? -129.60 -66.47 45 8 LYS A 31 ? ? -120.99 -154.38 46 8 ARG A 50 ? ? -120.57 -51.03 47 8 VAL A 66 ? ? -67.58 87.07 48 8 ARG A 79 ? ? -89.17 49.18 49 8 GLN A 91 ? ? -161.30 -169.90 50 9 ASN A 15 ? ? -166.21 42.54 51 9 GLN A 29 ? ? -122.65 -165.80 52 9 ASP A 30 ? ? -169.84 20.39 53 9 LEU A 58 ? ? -90.35 -64.02 54 9 ARG A 79 ? ? -90.90 57.65 55 9 SER A 81 ? ? -108.43 -167.20 56 10 LYS A 13 ? ? -69.09 94.01 57 10 MET A 17 ? ? -87.27 -73.02 58 10 GLN A 29 ? ? -117.68 -163.01 59 10 ASP A 30 ? ? -170.29 20.64 60 10 ARG A 50 ? ? -146.27 -67.13 61 10 ALA A 52 ? ? -129.81 -162.20 62 10 SER A 81 ? ? -102.00 -169.76 63 11 PRO A 4 ? ? -58.00 170.61 64 11 ASN A 15 ? ? -154.13 42.66 65 11 ALA A 44 ? ? -100.08 -62.20 66 11 ARG A 79 ? ? -93.77 59.96 67 11 SER A 81 ? ? -71.99 -169.17 68 11 GLN A 91 ? ? -155.54 -159.41 69 12 ASN A 15 ? ? -161.39 43.19 70 12 ASP A 30 ? ? -95.15 30.80 71 12 LYS A 31 ? ? -130.96 -148.20 72 12 ARG A 50 ? ? -142.79 31.89 73 12 ARG A 79 ? ? -93.44 40.33 74 12 SER A 81 ? ? -103.57 -165.02 75 12 GLN A 91 ? ? -148.01 -159.28 76 13 GLU A 3 ? ? 67.29 114.19 77 13 PRO A 4 ? ? -55.70 176.35 78 13 ASN A 15 ? ? -161.73 43.21 79 13 LYS A 31 ? ? -118.06 -158.51 80 13 VAL A 60 ? ? -102.90 -167.61 81 13 ASP A 61 ? ? -67.22 68.81 82 13 LEU A 65 ? ? -102.02 68.60 83 14 LEU A 58 ? ? -95.64 -61.38 84 14 ARG A 79 ? ? -87.10 49.67 85 14 SER A 81 ? ? -101.87 -168.10 86 14 GLN A 91 ? ? -161.19 -165.80 87 15 LYS A 2 ? ? -158.62 29.85 88 15 LYS A 13 ? ? -56.25 103.76 89 15 ASN A 15 ? ? -149.54 38.81 90 15 LYS A 31 ? ? -124.21 -149.58 91 15 LEU A 58 ? ? -105.99 -60.56 92 15 ARG A 79 ? ? -89.79 49.54 93 15 GLN A 91 ? ? -163.12 -167.01 94 16 LYS A 2 ? ? -90.14 52.90 95 16 GLN A 14 ? ? -102.59 66.10 96 16 MET A 17 ? ? -147.61 -72.99 97 16 GLN A 29 ? ? -123.94 -164.65 98 16 ASP A 30 ? ? -173.39 21.24 99 16 LEU A 58 ? ? -120.80 -59.59 100 16 ARG A 79 ? ? -90.68 59.03 101 16 SER A 81 ? ? -79.40 -165.69 102 17 LYS A 2 ? ? 69.08 136.45 103 17 PRO A 4 ? ? -55.83 170.36 104 17 MET A 17 ? ? -112.31 -73.48 105 17 GLN A 29 ? ? -133.49 -159.80 106 17 ASP A 30 ? ? -173.78 31.68 107 17 LEU A 58 ? ? -108.47 -61.40 108 17 LEU A 65 ? ? -100.74 76.89 109 17 ARG A 79 ? ? -91.52 48.24 110 17 GLN A 91 ? ? -160.96 -166.77 111 18 ASN A 15 ? ? -160.39 44.12 112 18 LYS A 31 ? ? -120.29 -157.77 113 18 ARG A 50 ? ? -123.37 -50.90 114 18 ARG A 79 ? ? -88.81 46.04 115 19 LYS A 2 ? ? 67.08 156.85 116 19 ASN A 15 ? ? -158.01 37.40 117 19 GLN A 29 ? ? -118.81 -163.11 118 19 ASP A 30 ? ? -168.13 18.71 119 19 LYS A 41 ? ? -68.28 91.08 120 19 ARG A 50 ? ? -143.18 -50.62 121 19 LEU A 58 ? ? -120.41 -55.93 122 19 ARG A 79 ? ? -91.19 51.68 123 19 SER A 81 ? ? -110.58 -165.50 124 20 GLU A 3 ? ? 64.66 102.22 125 20 ASN A 15 ? ? -154.46 36.30 126 20 ARG A 50 ? ? -133.88 -49.58 127 20 ALA A 52 ? ? -126.73 -169.47 128 20 LEU A 58 ? ? -121.05 -58.49 129 20 GLU A 75 ? ? -37.88 -39.93 130 20 ARG A 79 ? ? -90.85 31.93 131 20 SER A 81 ? ? -129.35 -160.68 132 20 GLN A 91 ? ? -124.55 -165.71 # _pdbx_nmr_ensemble.entry_id 1T2M _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T2M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50mM phosphate buffer NA; 1mM EDTA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM phosphate, 1mM EDTA' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1T2M _pdbx_nmr_details.text 'structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_refine.entry_id 1T2M _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details 'The structure was also refined with CSI version 1.0 (authors: David S. Wishart)' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.2 processing 'F. Delaglio' 1 CNS 1.1 'structure solution' 'A.T. Brunger' 2 CNS 1.1 refinement ? 3 MOLMOL 2K.2 'data analysis' 'Reto Koradi' 4 Sparky 3 processing 'T.D. Goddard' 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 94 ? A LEU 94 2 1 Y 1 A GLU 95 ? A GLU 95 3 1 Y 1 A HIS 96 ? A HIS 96 4 1 Y 1 A HIS 97 ? A HIS 97 5 1 Y 1 A HIS 98 ? A HIS 98 6 1 Y 1 A HIS 99 ? A HIS 99 7 1 Y 1 A HIS 100 ? A HIS 100 8 1 Y 1 A HIS 101 ? A HIS 101 9 2 Y 1 A LEU 94 ? A LEU 94 10 2 Y 1 A GLU 95 ? A GLU 95 11 2 Y 1 A HIS 96 ? A HIS 96 12 2 Y 1 A HIS 97 ? A HIS 97 13 2 Y 1 A HIS 98 ? A HIS 98 14 2 Y 1 A HIS 99 ? A HIS 99 15 2 Y 1 A HIS 100 ? A HIS 100 16 2 Y 1 A HIS 101 ? A HIS 101 17 3 Y 1 A LEU 94 ? A LEU 94 18 3 Y 1 A GLU 95 ? A GLU 95 19 3 Y 1 A HIS 96 ? A HIS 96 20 3 Y 1 A HIS 97 ? A HIS 97 21 3 Y 1 A HIS 98 ? A HIS 98 22 3 Y 1 A HIS 99 ? A HIS 99 23 3 Y 1 A HIS 100 ? A HIS 100 24 3 Y 1 A HIS 101 ? A HIS 101 25 4 Y 1 A LEU 94 ? A LEU 94 26 4 Y 1 A GLU 95 ? A GLU 95 27 4 Y 1 A HIS 96 ? A HIS 96 28 4 Y 1 A HIS 97 ? A HIS 97 29 4 Y 1 A HIS 98 ? A HIS 98 30 4 Y 1 A HIS 99 ? A HIS 99 31 4 Y 1 A HIS 100 ? A HIS 100 32 4 Y 1 A HIS 101 ? A HIS 101 33 5 Y 1 A LEU 94 ? A LEU 94 34 5 Y 1 A GLU 95 ? A GLU 95 35 5 Y 1 A HIS 96 ? A HIS 96 36 5 Y 1 A HIS 97 ? A HIS 97 37 5 Y 1 A HIS 98 ? A HIS 98 38 5 Y 1 A HIS 99 ? A HIS 99 39 5 Y 1 A HIS 100 ? A HIS 100 40 5 Y 1 A HIS 101 ? A HIS 101 41 6 Y 1 A LEU 94 ? A LEU 94 42 6 Y 1 A GLU 95 ? A GLU 95 43 6 Y 1 A HIS 96 ? A HIS 96 44 6 Y 1 A HIS 97 ? A HIS 97 45 6 Y 1 A HIS 98 ? A HIS 98 46 6 Y 1 A HIS 99 ? A HIS 99 47 6 Y 1 A HIS 100 ? A HIS 100 48 6 Y 1 A HIS 101 ? A HIS 101 49 7 Y 1 A LEU 94 ? A LEU 94 50 7 Y 1 A GLU 95 ? A GLU 95 51 7 Y 1 A HIS 96 ? A HIS 96 52 7 Y 1 A HIS 97 ? A HIS 97 53 7 Y 1 A HIS 98 ? A HIS 98 54 7 Y 1 A HIS 99 ? A HIS 99 55 7 Y 1 A HIS 100 ? A HIS 100 56 7 Y 1 A HIS 101 ? A HIS 101 57 8 Y 1 A LEU 94 ? A LEU 94 58 8 Y 1 A GLU 95 ? A GLU 95 59 8 Y 1 A HIS 96 ? A HIS 96 60 8 Y 1 A HIS 97 ? A HIS 97 61 8 Y 1 A HIS 98 ? A HIS 98 62 8 Y 1 A HIS 99 ? A HIS 99 63 8 Y 1 A HIS 100 ? A HIS 100 64 8 Y 1 A HIS 101 ? A HIS 101 65 9 Y 1 A LEU 94 ? A LEU 94 66 9 Y 1 A GLU 95 ? A GLU 95 67 9 Y 1 A HIS 96 ? A HIS 96 68 9 Y 1 A HIS 97 ? A HIS 97 69 9 Y 1 A HIS 98 ? A HIS 98 70 9 Y 1 A HIS 99 ? A HIS 99 71 9 Y 1 A HIS 100 ? A HIS 100 72 9 Y 1 A HIS 101 ? A HIS 101 73 10 Y 1 A LEU 94 ? A LEU 94 74 10 Y 1 A GLU 95 ? A GLU 95 75 10 Y 1 A HIS 96 ? A HIS 96 76 10 Y 1 A HIS 97 ? A HIS 97 77 10 Y 1 A HIS 98 ? A HIS 98 78 10 Y 1 A HIS 99 ? A HIS 99 79 10 Y 1 A HIS 100 ? A HIS 100 80 10 Y 1 A HIS 101 ? A HIS 101 81 11 Y 1 A LEU 94 ? A LEU 94 82 11 Y 1 A GLU 95 ? A GLU 95 83 11 Y 1 A HIS 96 ? A HIS 96 84 11 Y 1 A HIS 97 ? A HIS 97 85 11 Y 1 A HIS 98 ? A HIS 98 86 11 Y 1 A HIS 99 ? A HIS 99 87 11 Y 1 A HIS 100 ? A HIS 100 88 11 Y 1 A HIS 101 ? A HIS 101 89 12 Y 1 A LEU 94 ? A LEU 94 90 12 Y 1 A GLU 95 ? A GLU 95 91 12 Y 1 A HIS 96 ? A HIS 96 92 12 Y 1 A HIS 97 ? A HIS 97 93 12 Y 1 A HIS 98 ? A HIS 98 94 12 Y 1 A HIS 99 ? A HIS 99 95 12 Y 1 A HIS 100 ? A HIS 100 96 12 Y 1 A HIS 101 ? A HIS 101 97 13 Y 1 A LEU 94 ? A LEU 94 98 13 Y 1 A GLU 95 ? A GLU 95 99 13 Y 1 A HIS 96 ? A HIS 96 100 13 Y 1 A HIS 97 ? A HIS 97 101 13 Y 1 A HIS 98 ? A HIS 98 102 13 Y 1 A HIS 99 ? A HIS 99 103 13 Y 1 A HIS 100 ? A HIS 100 104 13 Y 1 A HIS 101 ? A HIS 101 105 14 Y 1 A LEU 94 ? A LEU 94 106 14 Y 1 A GLU 95 ? A GLU 95 107 14 Y 1 A HIS 96 ? A HIS 96 108 14 Y 1 A HIS 97 ? A HIS 97 109 14 Y 1 A HIS 98 ? A HIS 98 110 14 Y 1 A HIS 99 ? A HIS 99 111 14 Y 1 A HIS 100 ? A HIS 100 112 14 Y 1 A HIS 101 ? A HIS 101 113 15 Y 1 A LEU 94 ? A LEU 94 114 15 Y 1 A GLU 95 ? A GLU 95 115 15 Y 1 A HIS 96 ? A HIS 96 116 15 Y 1 A HIS 97 ? A HIS 97 117 15 Y 1 A HIS 98 ? A HIS 98 118 15 Y 1 A HIS 99 ? A HIS 99 119 15 Y 1 A HIS 100 ? A HIS 100 120 15 Y 1 A HIS 101 ? A HIS 101 121 16 Y 1 A LEU 94 ? A LEU 94 122 16 Y 1 A GLU 95 ? A GLU 95 123 16 Y 1 A HIS 96 ? A HIS 96 124 16 Y 1 A HIS 97 ? A HIS 97 125 16 Y 1 A HIS 98 ? A HIS 98 126 16 Y 1 A HIS 99 ? A HIS 99 127 16 Y 1 A HIS 100 ? A HIS 100 128 16 Y 1 A HIS 101 ? A HIS 101 129 17 Y 1 A LEU 94 ? A LEU 94 130 17 Y 1 A GLU 95 ? A GLU 95 131 17 Y 1 A HIS 96 ? A HIS 96 132 17 Y 1 A HIS 97 ? A HIS 97 133 17 Y 1 A HIS 98 ? A HIS 98 134 17 Y 1 A HIS 99 ? A HIS 99 135 17 Y 1 A HIS 100 ? A HIS 100 136 17 Y 1 A HIS 101 ? A HIS 101 137 18 Y 1 A LEU 94 ? A LEU 94 138 18 Y 1 A GLU 95 ? A GLU 95 139 18 Y 1 A HIS 96 ? A HIS 96 140 18 Y 1 A HIS 97 ? A HIS 97 141 18 Y 1 A HIS 98 ? A HIS 98 142 18 Y 1 A HIS 99 ? A HIS 99 143 18 Y 1 A HIS 100 ? A HIS 100 144 18 Y 1 A HIS 101 ? A HIS 101 145 19 Y 1 A LEU 94 ? A LEU 94 146 19 Y 1 A GLU 95 ? A GLU 95 147 19 Y 1 A HIS 96 ? A HIS 96 148 19 Y 1 A HIS 97 ? A HIS 97 149 19 Y 1 A HIS 98 ? A HIS 98 150 19 Y 1 A HIS 99 ? A HIS 99 151 19 Y 1 A HIS 100 ? A HIS 100 152 19 Y 1 A HIS 101 ? A HIS 101 153 20 Y 1 A LEU 94 ? A LEU 94 154 20 Y 1 A GLU 95 ? A GLU 95 155 20 Y 1 A HIS 96 ? A HIS 96 156 20 Y 1 A HIS 97 ? A HIS 97 157 20 Y 1 A HIS 98 ? A HIS 98 158 20 Y 1 A HIS 99 ? A HIS 99 159 20 Y 1 A HIS 100 ? A HIS 100 160 20 Y 1 A HIS 101 ? A HIS 101 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1T2M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #