data_1T4N # _entry.id 1T4N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T4N pdb_00001t4n 10.2210/pdb1t4n/pdb RCSB RCSB022306 ? ? WWPDB D_1000022306 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1t4o _pdbx_database_related.details 'Same protein solved by x-ray crystallography' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T4N _pdbx_database_status.recvd_initial_deposition_date 2004-04-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Leulliot, N.' 1 'Quevillon-Cheruel, S.' 2 'Graille, M.' 3 'van Tilbeurgh, H.' 4 'Leeper, T.C.' 5 'Godin, K.S.' 6 'Edwards, T.E.' 7 'Sigurdsson, S.T.' 8 'Rozenkrants, N.' 9 'Nagel, R.J.' 10 'Ares, M.' 11 'Varani, G.' 12 # _citation.id primary _citation.title 'A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 23 _citation.page_first 2468 _citation.page_last 2477 _citation.year 2004 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15192703 _citation.pdbx_database_id_DOI 10.1038/sj.emboj.7600260 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Leulliot, N.' 1 ? primary 'Quevillon-Cheruel, S.' 2 ? primary 'Graille, M.' 3 ? primary 'Van Tilbeurgh, H.' 4 ? primary 'Leeper, T.C.' 5 ? primary 'Godin, K.S.' 6 ? primary 'Edwards, T.E.' 7 ? primary 'Sigurdsson, S.T.' 8 ? primary 'Rozenkrants, N.' 9 ? primary 'Nagel, R.J.' 10 ? primary 'Ares, M.' 11 ? primary 'Varani, G.' 12 ? # _cell.entry_id 1T4N _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1T4N _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribonuclease III' _entity.formula_weight 10453.133 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.26.3 _entity.pdbx_mutation ? _entity.pdbx_fragment dsRBD _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNase III, Rnt1p' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYA KQRAAALGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYA KQRAAALGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 LEU n 1 5 ASP n 1 6 MET n 1 7 ASN n 1 8 ALA n 1 9 LYS n 1 10 ARG n 1 11 GLN n 1 12 LEU n 1 13 TYR n 1 14 SER n 1 15 LEU n 1 16 ILE n 1 17 GLY n 1 18 TYR n 1 19 ALA n 1 20 SER n 1 21 LEU n 1 22 ARG n 1 23 LEU n 1 24 HIS n 1 25 TYR n 1 26 VAL n 1 27 THR n 1 28 VAL n 1 29 LYS n 1 30 LYS n 1 31 PRO n 1 32 THR n 1 33 ALA n 1 34 VAL n 1 35 ASP n 1 36 PRO n 1 37 ASN n 1 38 SER n 1 39 ILE n 1 40 VAL n 1 41 GLU n 1 42 CYS n 1 43 ARG n 1 44 VAL n 1 45 GLY n 1 46 ASP n 1 47 GLY n 1 48 THR n 1 49 VAL n 1 50 LEU n 1 51 GLY n 1 52 THR n 1 53 GLY n 1 54 VAL n 1 55 GLY n 1 56 ARG n 1 57 ASN n 1 58 ILE n 1 59 LYS n 1 60 ILE n 1 61 ALA n 1 62 GLY n 1 63 ILE n 1 64 ARG n 1 65 ALA n 1 66 ALA n 1 67 GLU n 1 68 ASN n 1 69 ALA n 1 70 LEU n 1 71 ARG n 1 72 ASP n 1 73 LYS n 1 74 LYS n 1 75 MET n 1 76 LEU n 1 77 ASP n 1 78 PHE n 1 79 TYR n 1 80 ALA n 1 81 LYS n 1 82 GLN n 1 83 ARG n 1 84 ALA n 1 85 ALA n 1 86 ALA n 1 87 LEU n 1 88 GLY n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n 1 94 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene 'RNT1, YMR239C, YM9408.01C, YM9959.21' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNT1_YEAST _struct_ref.pdbx_db_accession Q02555 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAK QRAA ; _struct_ref.pdbx_align_begin 364 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1T4N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02555 _struct_ref_seq.db_align_beg 364 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 447 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 364 _struct_ref_seq.pdbx_auth_seq_align_end 447 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1T4N MET A 1 ? UNP Q02555 ? ? 'initiating methionine' 363 1 1 1T4N ALA A 86 ? UNP Q02555 ? ? 'expression tag' 448 2 1 1T4N LEU A 87 ? UNP Q02555 ? ? 'expression tag' 449 3 1 1T4N GLY A 88 ? UNP Q02555 ? ? 'expression tag' 450 4 1 1T4N HIS A 89 ? UNP Q02555 ? ? 'expression tag' 451 5 1 1T4N HIS A 90 ? UNP Q02555 ? ? 'expression tag' 452 6 1 1T4N HIS A 91 ? UNP Q02555 ? ? 'expression tag' 453 7 1 1T4N HIS A 92 ? UNP Q02555 ? ? 'expression tag' 454 8 1 1T4N HIS A 93 ? UNP Q02555 ? ? 'expression tag' 455 9 1 1T4N HIS A 94 ? UNP Q02555 ? ? 'expression tag' 456 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM NACL' _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 500 ? 2 'AVANCE DMX' Bruker 600 ? 3 AVANCE Bruker 800 ? # _pdbx_nmr_ensemble.entry_id 1T4N _pdbx_nmr_ensemble.conformers_calculated_total_number 51 _pdbx_nmr_ensemble.conformers_submitted_total_number 51 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T4N _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure calculation' Sparky ? Goddard 2 'structure calculation' CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 3 # _exptl.entry_id 1T4N _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1T4N _struct.title 'Solution structure of Rnt1p dsRBD' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T4N _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'dsRBD, RNA-binding, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 5 ? ILE A 16 ? ASP A 367 ILE A 378 1 ? 12 HELX_P HELX_P2 2 ASN A 57 ? ASP A 72 ? ASN A 419 ASP A 434 1 ? 16 HELX_P HELX_P3 3 ASP A 72 ? GLY A 88 ? ASP A 434 GLY A 450 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 24 ? THR A 27 ? HIS A 386 THR A 389 A 2 SER A 38 ? ARG A 43 ? SER A 400 ARG A 405 A 3 VAL A 49 ? GLY A 55 ? VAL A 411 GLY A 417 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 24 ? N HIS A 386 O ARG A 43 ? O ARG A 405 A 2 3 N SER A 38 ? N SER A 400 O GLY A 55 ? O GLY A 417 # _database_PDB_matrix.entry_id 1T4N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1T4N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 363 363 MET MET A . n A 1 2 ASP 2 364 364 ASP ASP A . n A 1 3 LYS 3 365 365 LYS LYS A . n A 1 4 LEU 4 366 366 LEU LEU A . n A 1 5 ASP 5 367 367 ASP ASP A . n A 1 6 MET 6 368 368 MET MET A . n A 1 7 ASN 7 369 369 ASN ASN A . n A 1 8 ALA 8 370 370 ALA ALA A . n A 1 9 LYS 9 371 371 LYS LYS A . n A 1 10 ARG 10 372 372 ARG ARG A . n A 1 11 GLN 11 373 373 GLN GLN A . n A 1 12 LEU 12 374 374 LEU LEU A . n A 1 13 TYR 13 375 375 TYR TYR A . n A 1 14 SER 14 376 376 SER SER A . n A 1 15 LEU 15 377 377 LEU LEU A . n A 1 16 ILE 16 378 378 ILE ILE A . n A 1 17 GLY 17 379 379 GLY GLY A . n A 1 18 TYR 18 380 380 TYR TYR A . n A 1 19 ALA 19 381 381 ALA ALA A . n A 1 20 SER 20 382 382 SER SER A . n A 1 21 LEU 21 383 383 LEU LEU A . n A 1 22 ARG 22 384 384 ARG ARG A . n A 1 23 LEU 23 385 385 LEU LEU A . n A 1 24 HIS 24 386 386 HIS HIS A . n A 1 25 TYR 25 387 387 TYR TYR A . n A 1 26 VAL 26 388 388 VAL VAL A . n A 1 27 THR 27 389 389 THR THR A . n A 1 28 VAL 28 390 390 VAL VAL A . n A 1 29 LYS 29 391 391 LYS LYS A . n A 1 30 LYS 30 392 392 LYS LYS A . n A 1 31 PRO 31 393 393 PRO PRO A . n A 1 32 THR 32 394 394 THR THR A . n A 1 33 ALA 33 395 395 ALA ALA A . n A 1 34 VAL 34 396 396 VAL VAL A . n A 1 35 ASP 35 397 397 ASP ASP A . n A 1 36 PRO 36 398 398 PRO PRO A . n A 1 37 ASN 37 399 399 ASN ASN A . n A 1 38 SER 38 400 400 SER SER A . n A 1 39 ILE 39 401 401 ILE ILE A . n A 1 40 VAL 40 402 402 VAL VAL A . n A 1 41 GLU 41 403 403 GLU GLU A . n A 1 42 CYS 42 404 404 CYS CYS A . n A 1 43 ARG 43 405 405 ARG ARG A . n A 1 44 VAL 44 406 406 VAL VAL A . n A 1 45 GLY 45 407 407 GLY GLY A . n A 1 46 ASP 46 408 408 ASP ASP A . n A 1 47 GLY 47 409 409 GLY GLY A . n A 1 48 THR 48 410 410 THR THR A . n A 1 49 VAL 49 411 411 VAL VAL A . n A 1 50 LEU 50 412 412 LEU LEU A . n A 1 51 GLY 51 413 413 GLY GLY A . n A 1 52 THR 52 414 414 THR THR A . n A 1 53 GLY 53 415 415 GLY GLY A . n A 1 54 VAL 54 416 416 VAL VAL A . n A 1 55 GLY 55 417 417 GLY GLY A . n A 1 56 ARG 56 418 418 ARG ARG A . n A 1 57 ASN 57 419 419 ASN ASN A . n A 1 58 ILE 58 420 420 ILE ILE A . n A 1 59 LYS 59 421 421 LYS LYS A . n A 1 60 ILE 60 422 422 ILE ILE A . n A 1 61 ALA 61 423 423 ALA ALA A . n A 1 62 GLY 62 424 424 GLY GLY A . n A 1 63 ILE 63 425 425 ILE ILE A . n A 1 64 ARG 64 426 426 ARG ARG A . n A 1 65 ALA 65 427 427 ALA ALA A . n A 1 66 ALA 66 428 428 ALA ALA A . n A 1 67 GLU 67 429 429 GLU GLU A . n A 1 68 ASN 68 430 430 ASN ASN A . n A 1 69 ALA 69 431 431 ALA ALA A . n A 1 70 LEU 70 432 432 LEU LEU A . n A 1 71 ARG 71 433 433 ARG ARG A . n A 1 72 ASP 72 434 434 ASP ASP A . n A 1 73 LYS 73 435 435 LYS LYS A . n A 1 74 LYS 74 436 436 LYS LYS A . n A 1 75 MET 75 437 437 MET MET A . n A 1 76 LEU 76 438 438 LEU LEU A . n A 1 77 ASP 77 439 439 ASP ASP A . n A 1 78 PHE 78 440 440 PHE PHE A . n A 1 79 TYR 79 441 441 TYR TYR A . n A 1 80 ALA 80 442 442 ALA ALA A . n A 1 81 LYS 81 443 443 LYS LYS A . n A 1 82 GLN 82 444 444 GLN GLN A . n A 1 83 ARG 83 445 445 ARG ARG A . n A 1 84 ALA 84 446 446 ALA ALA A . n A 1 85 ALA 85 447 447 ALA ALA A . n A 1 86 ALA 86 448 448 ALA ALA A . n A 1 87 LEU 87 449 449 LEU LEU A . n A 1 88 GLY 88 450 450 GLY GLY A . n A 1 89 HIS 89 451 ? ? ? A . n A 1 90 HIS 90 452 ? ? ? A . n A 1 91 HIS 91 453 ? ? ? A . n A 1 92 HIS 92 454 ? ? ? A . n A 1 93 HIS 93 455 ? ? ? A . n A 1 94 HIS 94 456 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-07-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' diffrn 3 4 'Structure model' diffrn_radiation 4 4 'Structure model' diffrn_radiation_wavelength 5 4 'Structure model' pdbx_nmr_software 6 4 'Structure model' pdbx_nmr_spectrometer 7 4 'Structure model' pdbx_struct_assembly 8 4 'Structure model' pdbx_struct_oper_list 9 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.authors' 4 4 'Structure model' '_pdbx_nmr_software.classification' 5 4 'Structure model' '_pdbx_nmr_software.name' 6 4 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 7 4 'Structure model' '_pdbx_nmr_spectrometer.model' 8 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 2 2 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 3 3 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 4 4 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 5 5 O A TYR 441 ? ? H A ARG 445 ? ? 1.58 6 6 O A TYR 441 ? ? H A ARG 445 ? ? 1.57 7 7 O A LEU 374 ? ? H A ILE 378 ? ? 1.59 8 8 O A TYR 441 ? ? H A ARG 445 ? ? 1.59 9 9 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 10 10 O A TYR 441 ? ? H A ARG 445 ? ? 1.57 11 11 O A TYR 441 ? ? H A ARG 445 ? ? 1.57 12 12 O A TYR 441 ? ? H A ARG 445 ? ? 1.58 13 13 O A TYR 441 ? ? H A ARG 445 ? ? 1.54 14 14 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 15 15 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 16 16 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 17 17 O A TYR 441 ? ? H A ARG 445 ? ? 1.57 18 18 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 19 18 O A TYR 441 ? ? H A GLN 444 ? ? 1.59 20 19 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 21 20 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 22 21 O A TYR 441 ? ? H A ARG 445 ? ? 1.59 23 22 O A TYR 441 ? ? H A ARG 445 ? ? 1.59 24 23 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 25 23 O A LEU 438 ? ? H A ALA 442 ? ? 1.59 26 24 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 27 25 O A TYR 441 ? ? H A ARG 445 ? ? 1.59 28 26 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 29 27 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 30 28 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 31 29 O A TYR 441 ? ? H A ARG 445 ? ? 1.54 32 30 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 33 31 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 34 32 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 35 32 O A LEU 438 ? ? H A ALA 442 ? ? 1.58 36 33 O A TYR 441 ? ? H A ARG 445 ? ? 1.57 37 34 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 38 35 O A TYR 441 ? ? H A ARG 445 ? ? 1.58 39 36 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 40 37 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 41 38 O A TYR 441 ? ? H A ARG 445 ? ? 1.60 42 39 O A TYR 441 ? ? H A ARG 445 ? ? 1.57 43 40 O A TYR 441 ? ? H A ARG 445 ? ? 1.59 44 41 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 45 42 O A TYR 441 ? ? H A ARG 445 ? ? 1.58 46 43 O A TYR 441 ? ? H A ARG 445 ? ? 1.54 47 44 O A TYR 441 ? ? H A ARG 445 ? ? 1.58 48 45 O A TYR 441 ? ? H A ARG 445 ? ? 1.59 49 46 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 50 47 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 51 48 O A TYR 441 ? ? H A GLN 444 ? ? 1.57 52 49 O A TYR 441 ? ? H A ARG 445 ? ? 1.55 53 50 O A TYR 441 ? ? H A ARG 445 ? ? 1.56 54 50 O A LEU 374 ? ? H A ILE 378 ? ? 1.60 55 51 O A TYR 441 ? ? H A ARG 445 ? ? 1.54 56 51 O A TYR 441 ? ? H A GLN 444 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 365 ? ? -171.17 -41.87 2 1 MET A 368 ? ? -50.30 -71.36 3 1 ILE A 378 ? ? -137.18 -34.08 4 1 ALA A 381 ? ? 175.28 -69.13 5 1 ARG A 384 ? ? -63.98 80.79 6 1 LYS A 391 ? ? -48.27 -80.70 7 1 LYS A 392 ? ? 66.31 61.70 8 1 THR A 394 ? ? -162.89 -84.65 9 1 ALA A 395 ? ? -134.43 -48.38 10 1 ASP A 408 ? ? -60.43 -75.69 11 1 ASP A 434 ? ? -63.46 82.04 12 2 LYS A 365 ? ? -174.83 -42.74 13 2 MET A 368 ? ? 26.91 -91.23 14 2 TYR A 380 ? ? -117.47 50.67 15 2 ALA A 381 ? ? 77.97 -71.55 16 2 ARG A 384 ? ? -68.51 70.49 17 2 LEU A 385 ? ? -57.60 102.72 18 2 LYS A 391 ? ? -47.02 172.82 19 2 LYS A 392 ? ? 179.40 72.96 20 2 THR A 394 ? ? 172.44 -39.93 21 2 ALA A 395 ? ? 173.17 -33.54 22 2 ASP A 408 ? ? -177.87 -40.25 23 2 ASP A 434 ? ? -65.21 78.38 24 2 ALA A 448 ? ? -59.32 -71.50 25 3 LYS A 365 ? ? -178.39 131.97 26 3 ALA A 381 ? ? 179.73 -72.75 27 3 ARG A 384 ? ? -63.29 80.84 28 3 LYS A 391 ? ? 33.74 -91.63 29 3 LYS A 392 ? ? 66.35 61.02 30 3 THR A 394 ? ? -159.06 -45.41 31 3 ALA A 395 ? ? -172.14 -40.45 32 3 ASP A 408 ? ? 78.32 -0.07 33 3 ASP A 434 ? ? -59.58 85.99 34 3 LEU A 449 ? ? -129.54 -53.91 35 4 LYS A 365 ? ? 90.32 -29.31 36 4 LEU A 366 ? ? -96.51 32.25 37 4 ASP A 367 ? ? 67.07 67.97 38 4 MET A 368 ? ? -68.00 59.16 39 4 ASN A 369 ? ? 177.33 -71.37 40 4 ALA A 381 ? ? 71.65 -62.93 41 4 ARG A 384 ? ? -64.64 79.99 42 4 LYS A 392 ? ? -172.18 144.58 43 4 THR A 394 ? ? -158.25 -61.44 44 4 ALA A 395 ? ? -173.65 -40.81 45 4 ASP A 434 ? ? -65.18 80.74 46 5 ASN A 369 ? ? -82.42 -75.98 47 5 ILE A 378 ? ? -149.91 -34.33 48 5 ALA A 381 ? ? 179.42 -74.25 49 5 ARG A 384 ? ? -66.64 76.81 50 5 LEU A 385 ? ? -57.15 99.91 51 5 LYS A 391 ? ? 42.01 -90.69 52 5 THR A 394 ? ? -100.45 -160.10 53 5 PRO A 398 ? ? -51.25 -72.13 54 5 ASN A 399 ? ? 175.79 177.32 55 5 ASP A 408 ? ? -174.52 27.39 56 6 ILE A 378 ? ? -138.02 -32.56 57 6 ALA A 381 ? ? 177.86 -72.54 58 6 ARG A 384 ? ? -64.46 81.08 59 6 LYS A 391 ? ? 59.36 -76.61 60 6 THR A 394 ? ? -159.37 -56.02 61 6 ALA A 395 ? ? -161.77 -56.00 62 6 ASN A 399 ? ? -121.98 -164.96 63 7 LYS A 365 ? ? 179.69 -38.17 64 7 ASP A 367 ? ? 171.15 75.48 65 7 MET A 368 ? ? -69.19 27.22 66 7 ASN A 369 ? ? -158.32 -59.68 67 7 ALA A 381 ? ? 169.29 -69.52 68 7 ARG A 384 ? ? -65.86 80.62 69 7 LYS A 391 ? ? -47.70 174.23 70 7 LYS A 392 ? ? 176.62 60.19 71 7 THR A 394 ? ? 179.14 -45.68 72 7 ALA A 395 ? ? -174.26 -41.32 73 7 ASP A 408 ? ? -165.89 -44.98 74 7 ASP A 434 ? ? -68.66 70.87 75 8 LYS A 365 ? ? -150.92 -45.07 76 8 ILE A 378 ? ? -149.19 -42.66 77 8 ALA A 381 ? ? 171.68 -68.28 78 8 ARG A 384 ? ? -66.54 79.13 79 8 LEU A 385 ? ? -58.53 105.74 80 8 LYS A 392 ? ? -171.75 125.99 81 8 THR A 394 ? ? -177.62 43.15 82 8 ALA A 395 ? ? 76.52 -55.49 83 8 ASP A 434 ? ? -67.45 74.72 84 9 LYS A 365 ? ? 79.70 -1.60 85 9 MET A 368 ? ? 42.03 -170.05 86 9 ILE A 378 ? ? -134.58 -37.58 87 9 TYR A 380 ? ? -92.98 -86.71 88 9 ALA A 381 ? ? -133.74 -44.03 89 9 LEU A 385 ? ? -57.34 106.50 90 9 LYS A 391 ? ? -49.71 -85.72 91 9 LYS A 392 ? ? 69.36 61.46 92 9 THR A 394 ? ? -160.36 -51.06 93 9 ALA A 395 ? ? -175.08 -40.12 94 10 LYS A 365 ? ? 175.66 -36.05 95 10 ASP A 367 ? ? -156.63 57.52 96 10 ASN A 369 ? ? 62.97 -74.84 97 10 ILE A 378 ? ? -146.66 -38.64 98 10 ALA A 381 ? ? -161.95 -72.74 99 10 LEU A 383 ? ? -67.03 81.06 100 10 ARG A 384 ? ? -68.41 67.92 101 10 LEU A 385 ? ? -57.89 98.54 102 10 THR A 394 ? ? -155.40 -58.04 103 10 ALA A 395 ? ? -176.05 -39.64 104 10 ASP A 434 ? ? -61.01 84.68 105 11 LYS A 365 ? ? 174.98 -22.93 106 11 LEU A 366 ? ? -89.75 34.47 107 11 MET A 368 ? ? 44.74 -170.87 108 11 ILE A 378 ? ? -141.28 -35.54 109 11 TYR A 380 ? ? -86.71 -83.85 110 11 ALA A 381 ? ? -141.01 -47.50 111 11 LEU A 385 ? ? -56.19 102.38 112 11 VAL A 390 ? ? -103.77 -70.90 113 11 LYS A 391 ? ? 81.77 -26.58 114 11 ALA A 395 ? ? 178.70 -36.98 115 11 ASP A 397 ? ? 62.02 96.00 116 11 ASP A 434 ? ? -65.30 80.55 117 12 LYS A 365 ? ? -146.27 -40.83 118 12 LEU A 366 ? ? -95.12 38.24 119 12 ASN A 369 ? ? -63.83 -73.88 120 12 ILE A 378 ? ? -147.38 -34.06 121 12 ALA A 381 ? ? 179.43 -81.19 122 12 ARG A 384 ? ? -62.28 80.50 123 12 LEU A 385 ? ? -64.97 98.32 124 12 LYS A 391 ? ? -42.07 -91.97 125 12 LYS A 392 ? ? 64.19 60.83 126 12 THR A 394 ? ? -164.99 -169.40 127 12 VAL A 396 ? ? -100.42 -61.98 128 12 ASN A 399 ? ? -142.56 -157.44 129 12 ASP A 434 ? ? -66.27 76.73 130 13 LEU A 366 ? ? -138.49 -43.36 131 13 ASP A 367 ? ? -177.82 35.17 132 13 MET A 368 ? ? -47.07 173.13 133 13 ASN A 369 ? ? 56.99 -82.22 134 13 ILE A 378 ? ? -135.18 -32.36 135 13 ALA A 381 ? ? 178.05 -75.96 136 13 ARG A 384 ? ? -68.24 71.33 137 13 LEU A 385 ? ? -54.07 103.56 138 13 THR A 394 ? ? -160.28 -80.89 139 13 ALA A 395 ? ? -151.81 20.15 140 13 VAL A 396 ? ? -140.32 -39.66 141 13 ASN A 399 ? ? -134.86 -159.51 142 13 ASP A 434 ? ? -68.17 73.73 143 14 ASP A 364 ? ? -167.38 -42.28 144 14 ASP A 367 ? ? -158.61 26.04 145 14 MET A 368 ? ? 42.29 -169.37 146 14 ILE A 378 ? ? -134.21 -31.80 147 14 ALA A 381 ? ? 70.89 -63.31 148 14 ARG A 384 ? ? -63.86 80.11 149 14 LYS A 391 ? ? 28.52 -90.13 150 14 LYS A 392 ? ? 62.17 60.11 151 14 THR A 394 ? ? 177.78 -38.29 152 14 ALA A 395 ? ? -174.74 -34.90 153 14 ASN A 399 ? ? -136.10 -158.72 154 14 ASP A 408 ? ? -176.87 -42.85 155 14 ASP A 434 ? ? -67.26 74.55 156 15 ILE A 378 ? ? -136.94 -31.94 157 15 ALA A 381 ? ? -162.53 -68.84 158 15 LEU A 383 ? ? -68.66 77.95 159 15 ARG A 384 ? ? -67.34 73.87 160 15 LEU A 385 ? ? -50.84 96.12 161 15 LYS A 391 ? ? 33.32 -93.66 162 15 THR A 394 ? ? 178.23 61.43 163 15 ALA A 395 ? ? 77.39 -50.73 164 15 ASN A 399 ? ? -145.77 -83.12 165 16 ASN A 369 ? ? -63.35 -80.82 166 16 ILE A 378 ? ? -139.46 -43.03 167 16 ALA A 381 ? ? 178.26 -75.18 168 16 ARG A 384 ? ? -64.05 80.45 169 16 LEU A 385 ? ? -56.64 108.51 170 16 THR A 394 ? ? -132.13 -81.19 171 16 ALA A 395 ? ? -98.06 -73.01 172 16 ASP A 408 ? ? -178.33 -39.40 173 17 ASP A 364 ? ? 60.29 109.66 174 17 LYS A 365 ? ? -177.40 -36.45 175 17 LEU A 366 ? ? -142.10 54.19 176 17 ILE A 378 ? ? -135.39 -31.70 177 17 ALA A 381 ? ? 78.37 -68.85 178 17 LEU A 385 ? ? -50.45 100.77 179 17 LYS A 391 ? ? -25.91 -80.97 180 17 THR A 394 ? ? -157.56 -76.84 181 17 ALA A 395 ? ? -142.69 -47.29 182 17 ASN A 399 ? ? 161.76 -170.52 183 17 SER A 400 ? ? -68.76 95.95 184 17 LEU A 449 ? ? -97.63 -63.24 185 18 ASP A 364 ? ? 179.89 129.84 186 18 ASP A 367 ? ? 166.07 -21.83 187 18 MET A 368 ? ? 44.28 -167.88 188 18 ILE A 378 ? ? -138.43 -38.03 189 18 ALA A 381 ? ? 167.77 -82.86 190 18 LEU A 385 ? ? -45.65 101.77 191 18 LYS A 391 ? ? -38.86 -96.81 192 18 THR A 394 ? ? -162.47 -71.60 193 18 ALA A 395 ? ? -147.69 -46.36 194 18 ASP A 434 ? ? -64.78 80.89 195 19 LYS A 365 ? ? -178.36 -38.11 196 19 ASN A 369 ? ? -131.18 -40.33 197 19 ILE A 378 ? ? -138.66 -41.90 198 19 ALA A 381 ? ? -179.24 -80.55 199 19 ARG A 384 ? ? -69.21 66.53 200 19 LEU A 385 ? ? -54.12 96.78 201 19 LYS A 391 ? ? 50.63 100.12 202 19 LYS A 392 ? ? -119.05 58.40 203 19 THR A 394 ? ? -157.66 -46.30 204 19 ALA A 395 ? ? -161.45 -42.31 205 19 ASN A 399 ? ? 63.44 -171.07 206 19 ASP A 434 ? ? -67.93 72.20 207 19 LEU A 449 ? ? -151.35 -50.27 208 20 ASP A 364 ? ? 59.38 93.81 209 20 ASP A 367 ? ? 158.92 58.82 210 20 ASN A 369 ? ? -163.08 -74.61 211 20 ILE A 378 ? ? -134.67 -38.32 212 20 ALA A 381 ? ? -177.51 -76.36 213 20 ARG A 384 ? ? -70.00 66.98 214 20 LEU A 385 ? ? -53.70 98.56 215 20 THR A 394 ? ? -165.32 45.84 216 20 ALA A 395 ? ? 67.91 -73.31 217 20 ASP A 434 ? ? -66.69 81.11 218 21 LYS A 365 ? ? -155.53 -53.01 219 21 ILE A 378 ? ? -140.00 -35.71 220 21 ALA A 381 ? ? 77.67 -61.56 221 21 ARG A 384 ? ? -68.76 66.62 222 21 LEU A 385 ? ? -59.75 99.01 223 21 THR A 394 ? ? 68.61 142.51 224 21 ALA A 395 ? ? 65.46 -76.82 225 21 ASP A 434 ? ? -66.58 76.73 226 22 LYS A 365 ? ? -178.59 -37.17 227 22 ASN A 369 ? ? -100.88 -61.08 228 22 ILE A 378 ? ? -139.18 -33.81 229 22 ALA A 381 ? ? 169.64 -74.36 230 22 ARG A 384 ? ? -66.18 80.84 231 22 LEU A 385 ? ? -51.13 108.58 232 22 LYS A 391 ? ? -47.79 171.80 233 22 LYS A 392 ? ? 177.52 65.26 234 22 THR A 394 ? ? -171.00 -60.76 235 22 ALA A 395 ? ? -162.74 -43.75 236 22 ASP A 408 ? ? -167.32 -48.02 237 22 ASP A 434 ? ? -56.41 86.37 238 22 LEU A 449 ? ? -90.81 -62.50 239 23 ASP A 364 ? ? -147.10 -74.75 240 23 LYS A 365 ? ? 169.44 -17.08 241 23 LEU A 366 ? ? -87.43 33.18 242 23 MET A 368 ? ? 42.02 -164.98 243 23 ILE A 378 ? ? -139.33 -41.92 244 23 ALA A 381 ? ? 177.54 -75.09 245 23 ARG A 384 ? ? -66.26 77.53 246 23 LEU A 385 ? ? -58.55 104.62 247 23 ASP A 397 ? ? 53.69 76.09 248 23 ASN A 399 ? ? 175.50 155.07 249 23 ASP A 434 ? ? -58.96 92.16 250 23 ALA A 448 ? ? -77.25 -77.69 251 24 LYS A 365 ? ? -170.26 132.65 252 24 ILE A 378 ? ? -138.63 -34.33 253 24 ALA A 381 ? ? 168.13 -70.12 254 24 ARG A 384 ? ? -65.29 80.13 255 24 LEU A 385 ? ? -55.50 107.90 256 24 LYS A 391 ? ? 32.81 -92.67 257 24 THR A 394 ? ? -178.33 -82.38 258 24 ALA A 395 ? ? -139.86 -36.98 259 24 ASN A 399 ? ? -138.68 -82.22 260 24 ASP A 408 ? ? -65.73 -70.17 261 24 ASP A 434 ? ? -66.70 75.83 262 25 LYS A 365 ? ? 69.75 -178.23 263 25 MET A 368 ? ? 44.58 -171.10 264 25 ILE A 378 ? ? -133.80 -38.71 265 25 ALA A 381 ? ? -179.49 -78.79 266 25 ARG A 384 ? ? -69.58 69.43 267 25 LEU A 385 ? ? -59.20 101.97 268 25 LYS A 391 ? ? 39.08 -97.50 269 25 THR A 394 ? ? -158.46 -84.78 270 25 ALA A 395 ? ? -135.09 -48.68 271 25 ASN A 399 ? ? 163.58 -154.86 272 25 SER A 400 ? ? -60.22 96.54 273 25 ASP A 434 ? ? -50.83 93.33 274 25 LEU A 449 ? ? -168.26 -67.29 275 26 ILE A 378 ? ? -136.19 -40.64 276 26 ALA A 381 ? ? -176.34 -75.17 277 26 ARG A 384 ? ? -64.40 77.77 278 26 LEU A 385 ? ? -59.30 97.80 279 26 ASN A 399 ? ? 179.39 158.02 280 26 ASP A 434 ? ? -68.35 69.50 281 27 LYS A 365 ? ? 75.75 -61.12 282 27 ASP A 367 ? ? -172.40 35.53 283 27 MET A 368 ? ? 38.28 -92.11 284 27 ILE A 378 ? ? -140.75 -35.73 285 27 TYR A 380 ? ? -87.25 -82.68 286 27 ALA A 381 ? ? -135.23 -54.39 287 27 LEU A 383 ? ? -65.47 76.62 288 27 LEU A 385 ? ? -51.99 104.25 289 27 THR A 394 ? ? -157.09 -69.99 290 27 ALA A 395 ? ? -161.10 -44.31 291 27 LEU A 449 ? ? -134.14 -46.19 292 28 LYS A 365 ? ? -146.42 -47.31 293 28 MET A 368 ? ? -81.07 36.24 294 28 ASN A 369 ? ? -156.29 -54.72 295 28 ILE A 378 ? ? -139.26 -35.44 296 28 TYR A 380 ? ? -96.78 -88.27 297 28 ALA A 381 ? ? -134.60 -44.12 298 28 LEU A 385 ? ? -49.56 102.36 299 28 LYS A 391 ? ? -52.99 -176.62 300 28 LYS A 392 ? ? 173.11 64.53 301 28 THR A 394 ? ? 175.33 -39.21 302 28 ALA A 395 ? ? 174.45 -34.01 303 28 ASP A 434 ? ? -67.78 75.65 304 29 ALA A 381 ? ? 179.79 -75.48 305 29 ARG A 384 ? ? -63.08 80.04 306 29 LYS A 391 ? ? 41.48 94.02 307 29 LYS A 392 ? ? -108.05 70.19 308 29 THR A 394 ? ? 179.91 -41.09 309 29 ALA A 395 ? ? 179.67 -37.13 310 29 ASN A 399 ? ? -124.28 -163.46 311 29 ASP A 434 ? ? -63.85 81.18 312 29 LEU A 449 ? ? -137.00 -55.80 313 30 LYS A 365 ? ? -175.77 136.44 314 30 ASN A 369 ? ? -177.91 -73.55 315 30 ILE A 378 ? ? -137.83 -31.55 316 30 ALA A 381 ? ? 173.78 -67.85 317 30 ARG A 384 ? ? -63.54 80.68 318 30 LEU A 385 ? ? -59.20 106.16 319 30 THR A 394 ? ? -149.37 -78.19 320 30 ALA A 395 ? ? -152.92 -43.33 321 30 ASP A 434 ? ? -66.53 77.86 322 31 LEU A 366 ? ? -145.52 -51.62 323 31 ASP A 367 ? ? -153.22 17.40 324 31 MET A 368 ? ? 39.76 -167.80 325 31 ILE A 378 ? ? -135.85 -32.56 326 31 ALA A 381 ? ? 173.99 -67.57 327 31 ARG A 384 ? ? -68.98 80.87 328 31 ALA A 395 ? ? 60.11 -84.79 329 31 ASN A 399 ? ? 174.75 155.44 330 31 ASP A 434 ? ? -68.24 73.02 331 32 ASP A 364 ? ? 62.88 121.17 332 32 LYS A 365 ? ? -179.86 -34.40 333 32 ASP A 367 ? ? -160.27 28.73 334 32 MET A 368 ? ? 44.15 -170.84 335 32 ILE A 378 ? ? -138.57 -41.63 336 32 ALA A 381 ? ? 178.81 -77.69 337 32 ARG A 384 ? ? -67.75 75.60 338 32 LEU A 385 ? ? -53.65 100.90 339 32 LYS A 391 ? ? -44.46 165.67 340 32 LYS A 392 ? ? -150.60 78.73 341 32 ASP A 397 ? ? 49.59 71.07 342 32 ASN A 399 ? ? 174.72 172.23 343 32 ASP A 408 ? ? -177.71 -47.30 344 32 ASP A 434 ? ? -61.85 84.43 345 32 LEU A 449 ? ? -157.11 -44.83 346 33 ASP A 364 ? ? -171.64 149.16 347 33 LYS A 365 ? ? -178.55 -39.25 348 33 ASP A 367 ? ? 60.98 68.24 349 33 ILE A 378 ? ? -142.70 -35.61 350 33 ALA A 381 ? ? 70.38 -64.21 351 33 ARG A 384 ? ? -63.68 80.11 352 33 LYS A 391 ? ? 81.14 -20.26 353 33 THR A 394 ? ? -80.45 -75.00 354 33 ALA A 395 ? ? -130.35 -43.56 355 33 ASP A 397 ? ? 48.35 97.09 356 33 ASP A 408 ? ? -177.73 29.35 357 33 ASP A 434 ? ? -65.33 80.09 358 34 LYS A 365 ? ? -177.36 -39.23 359 34 LEU A 366 ? ? -96.76 30.65 360 34 ASP A 367 ? ? 56.21 70.76 361 34 ASN A 369 ? ? -131.88 -45.01 362 34 ILE A 378 ? ? -133.76 -32.89 363 34 ALA A 381 ? ? -146.79 -76.68 364 34 LEU A 383 ? ? -66.87 74.66 365 34 ARG A 384 ? ? -69.38 75.52 366 34 LEU A 385 ? ? -56.62 103.78 367 34 LYS A 391 ? ? 37.64 95.44 368 34 LYS A 392 ? ? -106.73 72.28 369 34 THR A 394 ? ? 177.47 -45.71 370 34 ALA A 395 ? ? -176.86 -38.20 371 34 ASN A 399 ? ? -123.08 -164.65 372 34 ASP A 408 ? ? -174.04 26.66 373 34 ASP A 434 ? ? -64.95 79.44 374 35 LYS A 365 ? ? 178.62 -35.50 375 35 MET A 368 ? ? 30.54 -91.61 376 35 ILE A 378 ? ? -142.80 -34.76 377 35 TYR A 380 ? ? -85.67 -80.95 378 35 ALA A 381 ? ? -138.07 -54.18 379 35 LEU A 383 ? ? -64.19 77.85 380 35 ARG A 384 ? ? -69.56 70.85 381 35 LEU A 385 ? ? -53.70 97.37 382 35 LYS A 391 ? ? -38.21 -90.25 383 35 THR A 394 ? ? -158.92 -77.91 384 35 ALA A 395 ? ? -139.42 -47.49 385 35 ASP A 408 ? ? -78.48 -70.75 386 36 ASP A 364 ? ? -167.78 -57.97 387 36 LYS A 365 ? ? 178.26 159.35 388 36 LEU A 366 ? ? 59.66 19.75 389 36 ASN A 369 ? ? -61.95 -79.81 390 36 ILE A 378 ? ? -136.62 -40.87 391 36 TYR A 380 ? ? -87.45 -78.24 392 36 ALA A 381 ? ? -140.36 -47.69 393 36 LEU A 383 ? ? -63.99 82.01 394 36 LEU A 385 ? ? -51.60 109.39 395 36 LYS A 391 ? ? 41.63 108.21 396 36 LYS A 392 ? ? -106.51 73.35 397 36 THR A 394 ? ? -93.90 55.88 398 36 VAL A 396 ? ? -142.91 -16.99 399 36 ASP A 397 ? ? 61.86 79.48 400 36 ASP A 434 ? ? -58.84 88.26 401 37 ASN A 369 ? ? -179.30 -73.89 402 37 ILE A 378 ? ? -139.06 -33.79 403 37 ALA A 381 ? ? -173.69 -81.45 404 37 ARG A 384 ? ? -67.88 72.30 405 37 LEU A 385 ? ? -59.31 97.25 406 37 THR A 394 ? ? -170.85 -49.66 407 37 ALA A 395 ? ? 179.23 -37.65 408 37 ASP A 434 ? ? -59.98 86.71 409 37 LEU A 449 ? ? -120.94 -64.33 410 38 ASP A 364 ? ? 61.16 83.15 411 38 LYS A 365 ? ? -165.96 -40.67 412 38 ILE A 378 ? ? -143.59 -30.94 413 38 TYR A 380 ? ? -109.25 45.45 414 38 ALA A 381 ? ? 74.23 -62.94 415 38 ARG A 384 ? ? -63.31 79.47 416 38 LEU A 385 ? ? -67.38 98.80 417 38 VAL A 390 ? ? -101.91 -67.88 418 38 LYS A 391 ? ? 64.74 -71.30 419 38 THR A 394 ? ? -161.64 116.63 420 38 ALA A 395 ? ? 59.96 -83.94 421 38 ASP A 397 ? ? 52.01 84.01 422 38 PRO A 398 ? ? -51.76 -73.69 423 38 ASN A 399 ? ? 176.37 167.76 424 38 ASP A 408 ? ? -149.54 30.88 425 38 ASP A 434 ? ? 45.28 90.71 426 38 LYS A 435 ? ? -24.99 -32.86 427 39 ILE A 378 ? ? -141.43 -33.43 428 39 TYR A 380 ? ? -83.55 -82.31 429 39 ALA A 381 ? ? -139.32 -54.82 430 39 LEU A 383 ? ? -63.34 81.19 431 39 LEU A 385 ? ? -58.71 100.63 432 39 VAL A 390 ? ? -107.73 -67.34 433 39 LYS A 391 ? ? 67.95 -65.51 434 39 ASP A 397 ? ? 43.75 75.88 435 39 PRO A 398 ? ? -55.69 -73.78 436 39 ASN A 399 ? ? 176.21 174.94 437 39 ASP A 434 ? ? -61.01 83.43 438 40 LYS A 365 ? ? -179.91 48.74 439 40 LEU A 366 ? ? -176.77 -58.64 440 40 ASP A 367 ? ? 170.70 40.82 441 40 ASN A 369 ? ? -96.63 -62.71 442 40 ILE A 378 ? ? -139.92 -34.37 443 40 ALA A 381 ? ? 170.06 -77.41 444 40 ARG A 384 ? ? -65.92 80.21 445 40 LEU A 385 ? ? -54.80 106.19 446 40 ASN A 399 ? ? 173.83 167.99 447 40 ASP A 408 ? ? -171.05 -42.39 448 40 ASP A 434 ? ? -68.71 72.69 449 40 ALA A 448 ? ? -82.13 -74.13 450 41 ASP A 364 ? ? -109.14 -167.66 451 41 MET A 368 ? ? 36.92 -92.00 452 41 ILE A 378 ? ? -137.30 -31.79 453 41 ALA A 381 ? ? 176.27 -71.81 454 41 ARG A 384 ? ? -64.02 80.81 455 41 LEU A 385 ? ? -57.79 103.99 456 41 LYS A 391 ? ? -122.00 -75.42 457 41 LYS A 392 ? ? 65.46 139.16 458 41 THR A 394 ? ? -159.85 45.67 459 41 ALA A 395 ? ? 69.21 -69.64 460 41 ASP A 408 ? ? -177.87 -39.51 461 42 LEU A 366 ? ? 38.09 33.09 462 42 ILE A 378 ? ? -143.75 -37.51 463 42 TYR A 380 ? ? -90.02 -84.88 464 42 ALA A 381 ? ? -133.34 -44.18 465 42 LEU A 383 ? ? -63.09 82.72 466 42 LEU A 385 ? ? -59.56 99.05 467 42 VAL A 390 ? ? -102.17 -69.09 468 42 THR A 394 ? ? -159.66 51.91 469 42 ALA A 395 ? ? 71.94 -64.32 470 42 ASP A 434 ? ? -64.15 81.22 471 43 LYS A 365 ? ? 179.77 -36.54 472 43 ILE A 378 ? ? -135.86 -38.41 473 43 ALA A 381 ? ? 78.96 -59.29 474 43 LEU A 385 ? ? -49.77 97.14 475 43 LYS A 392 ? ? -172.10 147.08 476 43 THR A 394 ? ? -165.88 38.24 477 43 ALA A 395 ? ? 74.09 -62.15 478 43 ASP A 434 ? ? -65.48 79.68 479 44 LYS A 365 ? ? 87.32 -45.03 480 44 LEU A 366 ? ? -96.86 38.96 481 44 ASP A 367 ? ? 63.71 66.58 482 44 ILE A 378 ? ? -139.36 -31.95 483 44 ALA A 381 ? ? 178.59 -69.59 484 44 ARG A 384 ? ? -64.49 80.85 485 44 THR A 394 ? ? -164.23 71.41 486 44 ALA A 395 ? ? 63.27 -80.88 487 44 ASP A 434 ? ? -57.21 83.34 488 45 LEU A 366 ? ? -145.51 -45.87 489 45 ASP A 367 ? ? -151.99 19.83 490 45 MET A 368 ? ? 40.62 -164.85 491 45 ILE A 378 ? ? -150.00 -33.26 492 45 ALA A 381 ? ? 169.47 -69.00 493 45 ARG A 384 ? ? -64.45 80.55 494 45 LEU A 385 ? ? -54.85 100.74 495 45 ASP A 397 ? ? 44.07 81.49 496 45 ASN A 399 ? ? 175.53 153.97 497 45 ASP A 434 ? ? -67.82 71.82 498 46 ASP A 367 ? ? -159.89 24.65 499 46 MET A 368 ? ? 42.80 -167.69 500 46 ILE A 378 ? ? -140.66 -35.00 501 46 ALA A 381 ? ? -179.61 -72.98 502 46 ARG A 384 ? ? -62.48 80.90 503 46 LYS A 391 ? ? 39.37 -91.63 504 46 LYS A 392 ? ? 67.67 61.05 505 46 ALA A 395 ? ? 64.61 -79.00 506 46 ASP A 397 ? ? 43.74 79.37 507 46 PRO A 398 ? ? -53.67 -73.02 508 46 ASN A 399 ? ? 174.63 170.33 509 46 ASP A 408 ? ? -93.96 -66.52 510 46 ASP A 434 ? ? -63.47 82.23 511 46 LEU A 449 ? ? -132.42 -61.83 512 47 LYS A 365 ? ? -177.66 -38.95 513 47 ASP A 367 ? ? -161.26 28.27 514 47 MET A 368 ? ? 43.24 -169.71 515 47 ILE A 378 ? ? -137.04 -35.09 516 47 ALA A 381 ? ? 177.70 -75.45 517 47 ARG A 384 ? ? -63.39 80.73 518 47 LEU A 385 ? ? -55.57 109.01 519 47 LYS A 391 ? ? -63.32 -172.21 520 47 LYS A 392 ? ? -175.59 104.30 521 47 THR A 394 ? ? -162.85 -72.69 522 47 ALA A 395 ? ? -149.92 -47.14 523 47 ASP A 408 ? ? -177.39 -39.91 524 47 ASP A 434 ? ? -60.51 85.85 525 47 LEU A 449 ? ? -144.40 -47.09 526 48 ASP A 364 ? ? -161.89 55.18 527 48 LYS A 365 ? ? 179.62 169.89 528 48 ASN A 369 ? ? 63.06 -81.60 529 48 ALA A 381 ? ? 170.52 -86.25 530 48 ARG A 384 ? ? -67.06 73.60 531 48 LEU A 385 ? ? -50.01 109.05 532 48 VAL A 390 ? ? -102.38 -72.09 533 48 LYS A 391 ? ? 43.62 -83.24 534 48 LYS A 392 ? ? 71.28 66.04 535 48 THR A 394 ? ? -148.80 -159.56 536 48 ASP A 397 ? ? 52.17 82.38 537 48 ASN A 399 ? ? 176.65 167.50 538 48 ASP A 434 ? ? -68.03 71.72 539 48 GLN A 444 ? ? -108.45 -61.07 540 48 LEU A 449 ? ? -100.82 -69.32 541 49 LYS A 365 ? ? -134.05 -41.54 542 49 ASN A 369 ? ? -163.00 -79.84 543 49 ILE A 378 ? ? -147.61 -37.60 544 49 ALA A 381 ? ? -179.36 -81.15 545 49 ARG A 384 ? ? -62.38 79.52 546 49 LEU A 385 ? ? -59.92 98.42 547 49 LYS A 391 ? ? -45.74 163.08 548 49 LYS A 392 ? ? -167.96 73.88 549 49 THR A 394 ? ? 175.27 -43.98 550 49 ALA A 395 ? ? 177.92 -35.91 551 49 ASP A 408 ? ? -178.43 -39.55 552 49 ASP A 434 ? ? -69.01 69.78 553 49 LEU A 449 ? ? -109.76 -65.68 554 50 LEU A 366 ? ? -134.41 -48.66 555 50 ASP A 367 ? ? -149.82 17.82 556 50 MET A 368 ? ? 41.98 -169.04 557 50 ALA A 381 ? ? -169.33 -74.30 558 50 LEU A 385 ? ? -49.92 107.90 559 50 LYS A 391 ? ? 37.80 -94.05 560 50 LYS A 392 ? ? 69.10 64.06 561 50 THR A 394 ? ? -163.01 -67.10 562 50 ALA A 395 ? ? -155.21 -46.20 563 50 ASP A 434 ? ? -67.35 75.02 564 50 LEU A 449 ? ? -99.00 -66.09 565 51 ASP A 364 ? ? 61.51 154.69 566 51 LYS A 365 ? ? 171.77 -26.01 567 51 LEU A 366 ? ? -88.75 32.88 568 51 MET A 368 ? ? 44.49 -171.27 569 51 ILE A 378 ? ? -136.98 -37.50 570 51 ALA A 381 ? ? 170.58 -82.63 571 51 LYS A 392 ? ? -174.20 141.19 572 51 THR A 394 ? ? -165.68 64.39 573 51 ALA A 395 ? ? 63.24 -80.84 574 51 ASP A 408 ? ? -177.97 -39.86 575 51 ASP A 434 ? ? -68.69 72.83 576 51 LEU A 449 ? ? -139.53 -49.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 451 ? A HIS 89 2 1 Y 1 A HIS 452 ? A HIS 90 3 1 Y 1 A HIS 453 ? A HIS 91 4 1 Y 1 A HIS 454 ? A HIS 92 5 1 Y 1 A HIS 455 ? A HIS 93 6 1 Y 1 A HIS 456 ? A HIS 94 7 2 Y 1 A HIS 451 ? A HIS 89 8 2 Y 1 A HIS 452 ? A HIS 90 9 2 Y 1 A HIS 453 ? A HIS 91 10 2 Y 1 A HIS 454 ? A HIS 92 11 2 Y 1 A HIS 455 ? A HIS 93 12 2 Y 1 A HIS 456 ? A HIS 94 13 3 Y 1 A HIS 451 ? A HIS 89 14 3 Y 1 A HIS 452 ? A HIS 90 15 3 Y 1 A HIS 453 ? A HIS 91 16 3 Y 1 A HIS 454 ? A HIS 92 17 3 Y 1 A HIS 455 ? A HIS 93 18 3 Y 1 A HIS 456 ? A HIS 94 19 4 Y 1 A HIS 451 ? A HIS 89 20 4 Y 1 A HIS 452 ? A HIS 90 21 4 Y 1 A HIS 453 ? A HIS 91 22 4 Y 1 A HIS 454 ? A HIS 92 23 4 Y 1 A HIS 455 ? A HIS 93 24 4 Y 1 A HIS 456 ? A HIS 94 25 5 Y 1 A HIS 451 ? A HIS 89 26 5 Y 1 A HIS 452 ? A HIS 90 27 5 Y 1 A HIS 453 ? A HIS 91 28 5 Y 1 A HIS 454 ? A HIS 92 29 5 Y 1 A HIS 455 ? A HIS 93 30 5 Y 1 A HIS 456 ? A HIS 94 31 6 Y 1 A HIS 451 ? A HIS 89 32 6 Y 1 A HIS 452 ? A HIS 90 33 6 Y 1 A HIS 453 ? A HIS 91 34 6 Y 1 A HIS 454 ? A HIS 92 35 6 Y 1 A HIS 455 ? A HIS 93 36 6 Y 1 A HIS 456 ? A HIS 94 37 7 Y 1 A HIS 451 ? A HIS 89 38 7 Y 1 A HIS 452 ? A HIS 90 39 7 Y 1 A HIS 453 ? A HIS 91 40 7 Y 1 A HIS 454 ? A HIS 92 41 7 Y 1 A HIS 455 ? A HIS 93 42 7 Y 1 A HIS 456 ? A HIS 94 43 8 Y 1 A HIS 451 ? A HIS 89 44 8 Y 1 A HIS 452 ? A HIS 90 45 8 Y 1 A HIS 453 ? A HIS 91 46 8 Y 1 A HIS 454 ? A HIS 92 47 8 Y 1 A HIS 455 ? A HIS 93 48 8 Y 1 A HIS 456 ? A HIS 94 49 9 Y 1 A HIS 451 ? A HIS 89 50 9 Y 1 A HIS 452 ? A HIS 90 51 9 Y 1 A HIS 453 ? A HIS 91 52 9 Y 1 A HIS 454 ? A HIS 92 53 9 Y 1 A HIS 455 ? A HIS 93 54 9 Y 1 A HIS 456 ? A HIS 94 55 10 Y 1 A HIS 451 ? A HIS 89 56 10 Y 1 A HIS 452 ? A HIS 90 57 10 Y 1 A HIS 453 ? A HIS 91 58 10 Y 1 A HIS 454 ? A HIS 92 59 10 Y 1 A HIS 455 ? A HIS 93 60 10 Y 1 A HIS 456 ? A HIS 94 61 11 Y 1 A HIS 451 ? A HIS 89 62 11 Y 1 A HIS 452 ? A HIS 90 63 11 Y 1 A HIS 453 ? A HIS 91 64 11 Y 1 A HIS 454 ? A HIS 92 65 11 Y 1 A HIS 455 ? A HIS 93 66 11 Y 1 A HIS 456 ? A HIS 94 67 12 Y 1 A HIS 451 ? A HIS 89 68 12 Y 1 A HIS 452 ? A HIS 90 69 12 Y 1 A HIS 453 ? A HIS 91 70 12 Y 1 A HIS 454 ? A HIS 92 71 12 Y 1 A HIS 455 ? A HIS 93 72 12 Y 1 A HIS 456 ? A HIS 94 73 13 Y 1 A HIS 451 ? A HIS 89 74 13 Y 1 A HIS 452 ? A HIS 90 75 13 Y 1 A HIS 453 ? A HIS 91 76 13 Y 1 A HIS 454 ? A HIS 92 77 13 Y 1 A HIS 455 ? A HIS 93 78 13 Y 1 A HIS 456 ? A HIS 94 79 14 Y 1 A HIS 451 ? A HIS 89 80 14 Y 1 A HIS 452 ? A HIS 90 81 14 Y 1 A HIS 453 ? A HIS 91 82 14 Y 1 A HIS 454 ? A HIS 92 83 14 Y 1 A HIS 455 ? A HIS 93 84 14 Y 1 A HIS 456 ? A HIS 94 85 15 Y 1 A HIS 451 ? A HIS 89 86 15 Y 1 A HIS 452 ? A HIS 90 87 15 Y 1 A HIS 453 ? A HIS 91 88 15 Y 1 A HIS 454 ? A HIS 92 89 15 Y 1 A HIS 455 ? A HIS 93 90 15 Y 1 A HIS 456 ? A HIS 94 91 16 Y 1 A HIS 451 ? A HIS 89 92 16 Y 1 A HIS 452 ? A HIS 90 93 16 Y 1 A HIS 453 ? A HIS 91 94 16 Y 1 A HIS 454 ? A HIS 92 95 16 Y 1 A HIS 455 ? A HIS 93 96 16 Y 1 A HIS 456 ? A HIS 94 97 17 Y 1 A HIS 451 ? A HIS 89 98 17 Y 1 A HIS 452 ? A HIS 90 99 17 Y 1 A HIS 453 ? A HIS 91 100 17 Y 1 A HIS 454 ? A HIS 92 101 17 Y 1 A HIS 455 ? A HIS 93 102 17 Y 1 A HIS 456 ? A HIS 94 103 18 Y 1 A HIS 451 ? A HIS 89 104 18 Y 1 A HIS 452 ? A HIS 90 105 18 Y 1 A HIS 453 ? A HIS 91 106 18 Y 1 A HIS 454 ? A HIS 92 107 18 Y 1 A HIS 455 ? A HIS 93 108 18 Y 1 A HIS 456 ? A HIS 94 109 19 Y 1 A HIS 451 ? A HIS 89 110 19 Y 1 A HIS 452 ? A HIS 90 111 19 Y 1 A HIS 453 ? A HIS 91 112 19 Y 1 A HIS 454 ? A HIS 92 113 19 Y 1 A HIS 455 ? A HIS 93 114 19 Y 1 A HIS 456 ? A HIS 94 115 20 Y 1 A HIS 451 ? A HIS 89 116 20 Y 1 A HIS 452 ? A HIS 90 117 20 Y 1 A HIS 453 ? A HIS 91 118 20 Y 1 A HIS 454 ? A HIS 92 119 20 Y 1 A HIS 455 ? A HIS 93 120 20 Y 1 A HIS 456 ? A HIS 94 121 21 Y 1 A HIS 451 ? A HIS 89 122 21 Y 1 A HIS 452 ? A HIS 90 123 21 Y 1 A HIS 453 ? A HIS 91 124 21 Y 1 A HIS 454 ? A HIS 92 125 21 Y 1 A HIS 455 ? A HIS 93 126 21 Y 1 A HIS 456 ? A HIS 94 127 22 Y 1 A HIS 451 ? A HIS 89 128 22 Y 1 A HIS 452 ? A HIS 90 129 22 Y 1 A HIS 453 ? A HIS 91 130 22 Y 1 A HIS 454 ? A HIS 92 131 22 Y 1 A HIS 455 ? A HIS 93 132 22 Y 1 A HIS 456 ? A HIS 94 133 23 Y 1 A HIS 451 ? A HIS 89 134 23 Y 1 A HIS 452 ? A HIS 90 135 23 Y 1 A HIS 453 ? A HIS 91 136 23 Y 1 A HIS 454 ? A HIS 92 137 23 Y 1 A HIS 455 ? A HIS 93 138 23 Y 1 A HIS 456 ? A HIS 94 139 24 Y 1 A HIS 451 ? A HIS 89 140 24 Y 1 A HIS 452 ? A HIS 90 141 24 Y 1 A HIS 453 ? A HIS 91 142 24 Y 1 A HIS 454 ? A HIS 92 143 24 Y 1 A HIS 455 ? A HIS 93 144 24 Y 1 A HIS 456 ? A HIS 94 145 25 Y 1 A HIS 451 ? A HIS 89 146 25 Y 1 A HIS 452 ? A HIS 90 147 25 Y 1 A HIS 453 ? A HIS 91 148 25 Y 1 A HIS 454 ? A HIS 92 149 25 Y 1 A HIS 455 ? A HIS 93 150 25 Y 1 A HIS 456 ? A HIS 94 151 26 Y 1 A HIS 451 ? A HIS 89 152 26 Y 1 A HIS 452 ? A HIS 90 153 26 Y 1 A HIS 453 ? A HIS 91 154 26 Y 1 A HIS 454 ? A HIS 92 155 26 Y 1 A HIS 455 ? A HIS 93 156 26 Y 1 A HIS 456 ? A HIS 94 157 27 Y 1 A HIS 451 ? A HIS 89 158 27 Y 1 A HIS 452 ? A HIS 90 159 27 Y 1 A HIS 453 ? A HIS 91 160 27 Y 1 A HIS 454 ? A HIS 92 161 27 Y 1 A HIS 455 ? A HIS 93 162 27 Y 1 A HIS 456 ? A HIS 94 163 28 Y 1 A HIS 451 ? A HIS 89 164 28 Y 1 A HIS 452 ? A HIS 90 165 28 Y 1 A HIS 453 ? A HIS 91 166 28 Y 1 A HIS 454 ? A HIS 92 167 28 Y 1 A HIS 455 ? A HIS 93 168 28 Y 1 A HIS 456 ? A HIS 94 169 29 Y 1 A HIS 451 ? A HIS 89 170 29 Y 1 A HIS 452 ? A HIS 90 171 29 Y 1 A HIS 453 ? A HIS 91 172 29 Y 1 A HIS 454 ? A HIS 92 173 29 Y 1 A HIS 455 ? A HIS 93 174 29 Y 1 A HIS 456 ? A HIS 94 175 30 Y 1 A HIS 451 ? A HIS 89 176 30 Y 1 A HIS 452 ? A HIS 90 177 30 Y 1 A HIS 453 ? A HIS 91 178 30 Y 1 A HIS 454 ? A HIS 92 179 30 Y 1 A HIS 455 ? A HIS 93 180 30 Y 1 A HIS 456 ? A HIS 94 181 31 Y 1 A HIS 451 ? A HIS 89 182 31 Y 1 A HIS 452 ? A HIS 90 183 31 Y 1 A HIS 453 ? A HIS 91 184 31 Y 1 A HIS 454 ? A HIS 92 185 31 Y 1 A HIS 455 ? A HIS 93 186 31 Y 1 A HIS 456 ? A HIS 94 187 32 Y 1 A HIS 451 ? A HIS 89 188 32 Y 1 A HIS 452 ? A HIS 90 189 32 Y 1 A HIS 453 ? A HIS 91 190 32 Y 1 A HIS 454 ? A HIS 92 191 32 Y 1 A HIS 455 ? A HIS 93 192 32 Y 1 A HIS 456 ? A HIS 94 193 33 Y 1 A HIS 451 ? A HIS 89 194 33 Y 1 A HIS 452 ? A HIS 90 195 33 Y 1 A HIS 453 ? A HIS 91 196 33 Y 1 A HIS 454 ? A HIS 92 197 33 Y 1 A HIS 455 ? A HIS 93 198 33 Y 1 A HIS 456 ? A HIS 94 199 34 Y 1 A HIS 451 ? A HIS 89 200 34 Y 1 A HIS 452 ? A HIS 90 201 34 Y 1 A HIS 453 ? A HIS 91 202 34 Y 1 A HIS 454 ? A HIS 92 203 34 Y 1 A HIS 455 ? A HIS 93 204 34 Y 1 A HIS 456 ? A HIS 94 205 35 Y 1 A HIS 451 ? A HIS 89 206 35 Y 1 A HIS 452 ? A HIS 90 207 35 Y 1 A HIS 453 ? A HIS 91 208 35 Y 1 A HIS 454 ? A HIS 92 209 35 Y 1 A HIS 455 ? A HIS 93 210 35 Y 1 A HIS 456 ? A HIS 94 211 36 Y 1 A HIS 451 ? A HIS 89 212 36 Y 1 A HIS 452 ? A HIS 90 213 36 Y 1 A HIS 453 ? A HIS 91 214 36 Y 1 A HIS 454 ? A HIS 92 215 36 Y 1 A HIS 455 ? A HIS 93 216 36 Y 1 A HIS 456 ? A HIS 94 217 37 Y 1 A HIS 451 ? A HIS 89 218 37 Y 1 A HIS 452 ? A HIS 90 219 37 Y 1 A HIS 453 ? A HIS 91 220 37 Y 1 A HIS 454 ? A HIS 92 221 37 Y 1 A HIS 455 ? A HIS 93 222 37 Y 1 A HIS 456 ? A HIS 94 223 38 Y 1 A HIS 451 ? A HIS 89 224 38 Y 1 A HIS 452 ? A HIS 90 225 38 Y 1 A HIS 453 ? A HIS 91 226 38 Y 1 A HIS 454 ? A HIS 92 227 38 Y 1 A HIS 455 ? A HIS 93 228 38 Y 1 A HIS 456 ? A HIS 94 229 39 Y 1 A HIS 451 ? A HIS 89 230 39 Y 1 A HIS 452 ? A HIS 90 231 39 Y 1 A HIS 453 ? A HIS 91 232 39 Y 1 A HIS 454 ? A HIS 92 233 39 Y 1 A HIS 455 ? A HIS 93 234 39 Y 1 A HIS 456 ? A HIS 94 235 40 Y 1 A HIS 451 ? A HIS 89 236 40 Y 1 A HIS 452 ? A HIS 90 237 40 Y 1 A HIS 453 ? A HIS 91 238 40 Y 1 A HIS 454 ? A HIS 92 239 40 Y 1 A HIS 455 ? A HIS 93 240 40 Y 1 A HIS 456 ? A HIS 94 241 41 Y 1 A HIS 451 ? A HIS 89 242 41 Y 1 A HIS 452 ? A HIS 90 243 41 Y 1 A HIS 453 ? A HIS 91 244 41 Y 1 A HIS 454 ? A HIS 92 245 41 Y 1 A HIS 455 ? A HIS 93 246 41 Y 1 A HIS 456 ? A HIS 94 247 42 Y 1 A HIS 451 ? A HIS 89 248 42 Y 1 A HIS 452 ? A HIS 90 249 42 Y 1 A HIS 453 ? A HIS 91 250 42 Y 1 A HIS 454 ? A HIS 92 251 42 Y 1 A HIS 455 ? A HIS 93 252 42 Y 1 A HIS 456 ? A HIS 94 253 43 Y 1 A HIS 451 ? A HIS 89 254 43 Y 1 A HIS 452 ? A HIS 90 255 43 Y 1 A HIS 453 ? A HIS 91 256 43 Y 1 A HIS 454 ? A HIS 92 257 43 Y 1 A HIS 455 ? A HIS 93 258 43 Y 1 A HIS 456 ? A HIS 94 259 44 Y 1 A HIS 451 ? A HIS 89 260 44 Y 1 A HIS 452 ? A HIS 90 261 44 Y 1 A HIS 453 ? A HIS 91 262 44 Y 1 A HIS 454 ? A HIS 92 263 44 Y 1 A HIS 455 ? A HIS 93 264 44 Y 1 A HIS 456 ? A HIS 94 265 45 Y 1 A HIS 451 ? A HIS 89 266 45 Y 1 A HIS 452 ? A HIS 90 267 45 Y 1 A HIS 453 ? A HIS 91 268 45 Y 1 A HIS 454 ? A HIS 92 269 45 Y 1 A HIS 455 ? A HIS 93 270 45 Y 1 A HIS 456 ? A HIS 94 271 46 Y 1 A HIS 451 ? A HIS 89 272 46 Y 1 A HIS 452 ? A HIS 90 273 46 Y 1 A HIS 453 ? A HIS 91 274 46 Y 1 A HIS 454 ? A HIS 92 275 46 Y 1 A HIS 455 ? A HIS 93 276 46 Y 1 A HIS 456 ? A HIS 94 277 47 Y 1 A HIS 451 ? A HIS 89 278 47 Y 1 A HIS 452 ? A HIS 90 279 47 Y 1 A HIS 453 ? A HIS 91 280 47 Y 1 A HIS 454 ? A HIS 92 281 47 Y 1 A HIS 455 ? A HIS 93 282 47 Y 1 A HIS 456 ? A HIS 94 283 48 Y 1 A HIS 451 ? A HIS 89 284 48 Y 1 A HIS 452 ? A HIS 90 285 48 Y 1 A HIS 453 ? A HIS 91 286 48 Y 1 A HIS 454 ? A HIS 92 287 48 Y 1 A HIS 455 ? A HIS 93 288 48 Y 1 A HIS 456 ? A HIS 94 289 49 Y 1 A HIS 451 ? A HIS 89 290 49 Y 1 A HIS 452 ? A HIS 90 291 49 Y 1 A HIS 453 ? A HIS 91 292 49 Y 1 A HIS 454 ? A HIS 92 293 49 Y 1 A HIS 455 ? A HIS 93 294 49 Y 1 A HIS 456 ? A HIS 94 295 50 Y 1 A HIS 451 ? A HIS 89 296 50 Y 1 A HIS 452 ? A HIS 90 297 50 Y 1 A HIS 453 ? A HIS 91 298 50 Y 1 A HIS 454 ? A HIS 92 299 50 Y 1 A HIS 455 ? A HIS 93 300 50 Y 1 A HIS 456 ? A HIS 94 301 51 Y 1 A HIS 451 ? A HIS 89 302 51 Y 1 A HIS 452 ? A HIS 90 303 51 Y 1 A HIS 453 ? A HIS 91 304 51 Y 1 A HIS 454 ? A HIS 92 305 51 Y 1 A HIS 455 ? A HIS 93 306 51 Y 1 A HIS 456 ? A HIS 94 #