data_1T4Y # _entry.id 1T4Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1T4Y RCSB RCSB022317 WWPDB D_1000022317 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1T4Z _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T4Y _pdbx_database_status.recvd_initial_deposition_date 2004-04-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vakonakis, I.' 1 'Klewer, D.A.' 2 'LiWang, A.C.' 3 # _citation.id primary _citation.title 'Structure of the N-terminal domain of the circadian clock-associated histidine kinase SasA.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 342 _citation.page_first 9 _citation.page_last 17 _citation.year 2004 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15313603 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2004.07.010 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vakonakis, I.' 1 primary 'Klewer, D.A.' 2 primary 'Williams, S.B.' 3 primary 'Golden, S.S.' 4 primary 'LiWang, A.C.' 5 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Adaptive-response sensory-kinase sasA' _entity.formula_weight 11483.250 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.-.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLVEYYRLVVTPALVKIGPGSRQV LSGIDLTDQLANQLPQWLVQQEGIF ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLVEYYRLVVTPALVKIGPGSRQV LSGIDLTDQLANQLPQWLVQQEGIF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 LEU n 1 5 SER n 1 6 PRO n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 ALA n 1 11 GLN n 1 12 PRO n 1 13 LEU n 1 14 LEU n 1 15 LEU n 1 16 GLN n 1 17 LEU n 1 18 PHE n 1 19 VAL n 1 20 ASP n 1 21 THR n 1 22 ARG n 1 23 PRO n 1 24 LEU n 1 25 SER n 1 26 GLN n 1 27 HIS n 1 28 ILE n 1 29 VAL n 1 30 GLN n 1 31 ARG n 1 32 VAL n 1 33 LYS n 1 34 ASN n 1 35 ILE n 1 36 LEU n 1 37 ALA n 1 38 ALA n 1 39 VAL n 1 40 GLU n 1 41 ALA n 1 42 THR n 1 43 VAL n 1 44 PRO n 1 45 ILE n 1 46 SER n 1 47 LEU n 1 48 GLN n 1 49 VAL n 1 50 ILE n 1 51 ASN n 1 52 VAL n 1 53 ALA n 1 54 ASP n 1 55 GLN n 1 56 PRO n 1 57 GLN n 1 58 LEU n 1 59 VAL n 1 60 GLU n 1 61 TYR n 1 62 TYR n 1 63 ARG n 1 64 LEU n 1 65 VAL n 1 66 VAL n 1 67 THR n 1 68 PRO n 1 69 ALA n 1 70 LEU n 1 71 VAL n 1 72 LYS n 1 73 ILE n 1 74 GLY n 1 75 PRO n 1 76 GLY n 1 77 SER n 1 78 ARG n 1 79 GLN n 1 80 VAL n 1 81 LEU n 1 82 SER n 1 83 GLY n 1 84 ILE n 1 85 ASP n 1 86 LEU n 1 87 THR n 1 88 ASP n 1 89 GLN n 1 90 LEU n 1 91 ALA n 1 92 ASN n 1 93 GLN n 1 94 LEU n 1 95 PRO n 1 96 GLN n 1 97 TRP n 1 98 LEU n 1 99 VAL n 1 100 GLN n 1 101 GLN n 1 102 GLU n 1 103 GLY n 1 104 ILE n 1 105 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Synechococcus _entity_src_gen.pdbx_gene_src_gene 'SASA, SARS' _entity_src_gen.gene_src_species 'Synechococcus elongatus' _entity_src_gen.gene_src_strain 'PCC 7942' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechococcus elongatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1140 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32a+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SASA_SYNP7 _struct_ref.pdbx_db_accession Q06904 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLVEYYRLVVTPALVKIGPGSRQVLS GIDLTDQLANQLPQWLVQQE ; _struct_ref.pdbx_align_begin 4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1T4Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q06904 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 102 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1T4Y GLY A 1 ? UNP Q06904 ? ? 'CLONING ARTIFACT' 1 1 1 1T4Y SER A 2 ? UNP Q06904 ? ? 'CLONING ARTIFACT' 2 2 1 1T4Y GLY A 103 ? UNP Q06904 ? ? 'CLONING ARTIFACT' 103 3 1 1T4Y ILE A 104 ? UNP Q06904 ? ? 'CLONING ARTIFACT' 104 4 1 1T4Y PHE A 105 ? UNP Q06904 ? ? 'CLONING ARTIFACT' 105 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 4D_13C/15N-separated_NOESY 2 2 1 4D_13C-separated_NOESY 3 3 1 3D_15N-separated_NOESY 4 3 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl, 20 mM NaPi' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.8mM N-SasA U-15N, 13C, 20mM phosphate buffer pH 7.0, 100mM NaCl, 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '0.8mM N-SasA U-15N, 13C, 20mM phosphate buffer pH 7.0, 100mM NaCl, 100% D2O' '100% D2O' 3 '0.8mM N-SasA U-15N, 20mM phosphate buffer pH 7.0, 100mM NaCl, 95% H2O, 5% D2O' '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 500 # _pdbx_nmr_refine.entry_id 1T4Y _pdbx_nmr_refine.method 'Distance geometry, Simulated annealing, Slow refinement in the presence of database potentials' _pdbx_nmr_refine.details ;The structure is based on 2267 restraints, 1764 were NOE, 197 dihedral angles, 71 couplings, 198 chemical shifts and 34 hydrogen bonds ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1T4Y _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1T4Y _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1T4Y _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR '6.1 Rec. C' collection 'Varian Assoc.' 1 NMRPipe '2.1 Rev. 2002.044.17.08' processing Delaglio 2 PIPP 4.2.6 'data analysis' Garrett 3 XPLOR-NIH 2.9.1 'structure solution' 'Clore, Kuszewski' 4 XPLOR-NIH 2.9.1 refinement 'Clore, Kuszewski' 5 # _exptl.entry_id 1T4Y _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1T4Y _struct.title 'Solution structure of the N-terminal domain of Synechococcus elongatus SasA (average minimized structure)' _struct.pdbx_descriptor 'Adaptive-response sensory-kinase sasA (E.C.2.7.-.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1T4Y _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Alpha/Beta protein, Thioredoxin fold, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 1 ? SER A 5 ? GLY A 1 SER A 5 5 ? 5 HELX_P HELX_P2 2 ARG A 22 ? GLU A 40 ? ARG A 22 GLU A 40 1 ? 19 HELX_P HELX_P3 3 GLN A 55 ? TYR A 62 ? GLN A 55 TYR A 62 1 ? 8 HELX_P HELX_P4 4 ASP A 85 ? VAL A 99 ? ASP A 85 VAL A 99 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 67 A . ? THR 67 A PRO 68 A ? PRO 68 A 1 0.87 2 GLY 74 A . ? GLY 74 A PRO 75 A ? PRO 75 A 1 0.54 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 45 ? ASN A 51 ? ILE A 45 ASN A 51 A 2 LEU A 13 ? VAL A 19 ? LEU A 13 VAL A 19 A 3 ALA A 69 ? GLY A 74 ? ALA A 69 GLY A 74 A 4 GLN A 79 ? SER A 82 ? GLN A 79 SER A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 46 ? O SER A 46 N LEU A 13 ? N LEU A 13 A 2 3 N LEU A 14 ? N LEU A 14 O GLY A 74 ? O GLY A 74 A 3 4 N LEU A 70 ? N LEU A 70 O LEU A 81 ? O LEU A 81 # _database_PDB_matrix.entry_id 1T4Y _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1T4Y _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 PHE 105 105 105 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 102 ? ? H A ILE 104 ? ? 0.32 2 1 O A SER 2 ? ? H A LEU 4 ? ? 0.74 3 1 O A GLN 101 ? ? H A GLY 103 ? ? 1.13 4 1 O A SER 2 ? ? N A LEU 4 ? ? 1.15 5 1 HG A SER 82 ? ? H A GLY 83 ? ? 1.19 6 1 O A GLU 102 ? ? N A ILE 104 ? ? 1.20 7 1 O A ASP 20 ? ? HG1 A THR 21 ? ? 1.24 8 1 C A GLU 102 ? ? H A ILE 104 ? ? 1.25 9 1 O A VAL 99 ? ? H A GLN 101 ? ? 1.26 10 1 HG12 A VAL 99 ? ? HG3 A GLN 101 ? ? 1.29 11 1 C A SER 2 ? ? H A LEU 4 ? ? 1.31 12 1 H A LEU 70 ? ? O A LEU 81 ? ? 1.42 13 1 HG11 A VAL 59 ? ? O A LEU 64 ? ? 1.43 14 1 O A GLY 83 ? ? H A ASP 85 ? ? 1.45 15 1 HE22 A GLN 79 ? ? OE1 A GLN 93 ? ? 1.46 16 1 O A LEU 90 ? ? H A LEU 94 ? ? 1.46 17 1 O A TRP 97 ? ? HG3 A GLN 100 ? ? 1.47 18 1 HD13 A LEU 58 ? ? N A VAL 59 ? ? 1.47 19 1 H A LEU 14 ? ? O A GLY 74 ? ? 1.48 20 1 O A LEU 86 ? ? H A LEU 90 ? ? 1.50 21 1 O A PRO 6 ? ? HB2 A GLN 7 ? ? 1.55 22 1 O A LEU 24 ? ? H A ILE 28 ? ? 1.56 23 1 O A GLN 89 ? ? H A GLN 93 ? ? 1.57 24 1 O A VAL 99 ? ? N A GLN 101 ? ? 1.57 25 1 O A GLN 101 ? ? N A GLY 103 ? ? 1.85 26 1 O A GLY 83 ? ? N A ASP 85 ? ? 1.90 27 1 O A SER 2 ? ? CA A LEU 4 ? ? 2.04 28 1 C A SER 2 ? ? N A LEU 4 ? ? 2.06 29 1 O A GLN 30 ? ? ND2 A ASN 34 ? ? 2.11 30 1 C A GLU 102 ? ? N A ILE 104 ? ? 2.12 31 1 O A SER 2 ? ? N A SER 5 ? ? 2.16 32 1 O A TRP 97 ? ? CG A GLN 100 ? ? 2.18 33 1 O A SER 82 ? ? OD1 A ASP 85 ? ? 2.18 34 1 O A GLU 102 ? ? CA A ILE 104 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -26.75 166.14 2 1 SER A 3 ? ? -0.30 19.69 3 1 LEU A 4 ? ? 92.73 -7.37 4 1 PRO A 6 ? ? -77.59 45.55 5 1 GLN A 7 ? ? 155.88 130.48 6 1 GLU A 40 ? ? 34.70 -107.04 7 1 ALA A 41 ? ? 82.85 169.77 8 1 ARG A 63 ? ? 54.39 3.38 9 1 ILE A 84 ? ? 31.83 5.72 10 1 GLN A 100 ? ? -8.81 41.46 11 1 GLU A 102 ? ? -40.29 56.04 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 22 ? ? 0.283 'SIDE CHAIN' 2 1 ARG A 31 ? ? 0.203 'SIDE CHAIN' 3 1 ARG A 63 ? ? 0.278 'SIDE CHAIN' 4 1 ARG A 78 ? ? 0.118 'SIDE CHAIN' #