data_1T6O # _entry.id 1T6O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T6O pdb_00001t6o 10.2210/pdb1t6o/pdb RCSB RCSB022379 ? ? WWPDB D_1000022379 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T6O _pdbx_database_status.recvd_initial_deposition_date 2004-05-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kingston, R.L.' 1 'Hamel, D.J.' 2 'Gay, L.S.' 3 'Dahlquist, F.W.' 4 'Matthews, B.W.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural basis for the attachment of a paramyxoviral polymerase to its template.' Proc.Natl.Acad.Sci.USA 101 8301 8306 2004 PNASA6 US 0027-8424 0040 ? 15159535 10.1073/pnas.0402690101 1 'Characterization of nucleocapsid binding by the measles and the mumps virus phosphoprotein' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kingston, R.L.' 1 ? primary 'Hamel, D.J.' 2 ? primary 'Gay, L.S.' 3 ? primary 'Dahlquist, F.W.' 4 ? primary 'Matthews, B.W.' 5 ? 1 'Kingston, R.L.' 6 ? 1 'Baase, W.A.' 7 ? 1 'Gay, L.S.' 8 ? # _cell.entry_id 1T6O _cell.length_a 42.226 _cell.length_b 42.226 _cell.length_c 81.778 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1T6O _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man phosphoprotein 5891.055 1 ? P458G 'residues 457-507' ;Chimeric molecule encompassing amino acids 457-507 of measles P (chain A) and 486-505 of measles N (chain B). They are connected by a flexible 8 amino acid linker (GS)4 (chain L) ; 2 polymer syn linker 594.534 1 ? ? ? ? 3 polymer man phosphoprotein 2162.453 1 ? ? 'residues 486-505' ? 4 water nat water 18.015 28 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GGASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK GGASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK A ? 2 'polypeptide(L)' no no GSGSGSGS GSGSGSGS L ? 3 'polypeptide(L)' no no QDSRRSADALLRLQAMAGIS QDSRRSADALLRLQAMAGIS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 ALA n 1 4 SER n 1 5 ARG n 1 6 SER n 1 7 VAL n 1 8 ILE n 1 9 ARG n 1 10 SER n 1 11 ILE n 1 12 ILE n 1 13 LYS n 1 14 SER n 1 15 SER n 1 16 ARG n 1 17 LEU n 1 18 GLU n 1 19 GLU n 1 20 ASP n 1 21 ARG n 1 22 LYS n 1 23 ARG n 1 24 TYR n 1 25 LEU n 1 26 MET n 1 27 THR n 1 28 LEU n 1 29 LEU n 1 30 ASP n 1 31 ASP n 1 32 ILE n 1 33 LYS n 1 34 GLY n 1 35 ALA n 1 36 ASN n 1 37 ASP n 1 38 LEU n 1 39 ALA n 1 40 LYS n 1 41 PHE n 1 42 HIS n 1 43 GLN n 1 44 MET n 1 45 LEU n 1 46 MET n 1 47 LYS n 1 48 ILE n 1 49 ILE n 1 50 MET n 1 51 LYS n 2 1 GLY n 2 2 SER n 2 3 GLY n 2 4 SER n 2 5 GLY n 2 6 SER n 2 7 GLY n 2 8 SER n 3 1 GLN n 3 2 ASP n 3 3 SER n 3 4 ARG n 3 5 ARG n 3 6 SER n 3 7 ALA n 3 8 ASP n 3 9 ALA n 3 10 LEU n 3 11 LEU n 3 12 ARG n 3 13 LEU n 3 14 GLN n 3 15 ALA n 3 16 MET n 3 17 ALA n 3 18 GLY n 3 19 ILE n 3 20 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? Morbillivirus P/V ? 'Moraten vaccine strain' ? ? ? ? 'Measles virus' 11234 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21-Star(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pET41a(+)' ? ? 3 1 sample ? ? ? ? Morbillivirus N ? 'Moraten vaccine strain' ? ? ? ? 'Measles virus' 11234 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21-Star(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pET41a(+)' ? ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'synthetic linker' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 GB AAF85668 9181875 1 GPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK 457 ? 2 GB AAF85667 9181874 3 QDSRRSADALLRLQAMAGIS 486 ? 3 PDB 1T6O 1T6O 2 GSGSGSGS 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1T6O A 1 ? 51 ? 9181875 457 ? 507 ? 457 507 2 2 1T6O B 1 ? 20 ? 9181874 486 ? 505 ? 486 505 3 3 1T6O L 1 ? 8 ? 1T6O 478 ? 485 ? 478 485 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1T6O _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 2 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name GB _struct_ref_seq_dif.pdbx_seq_db_accession_code 9181875 _struct_ref_seq_dif.db_mon_id PRO _struct_ref_seq_dif.pdbx_seq_db_seq_num 458 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 458 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1T6O _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 41.64 _exptl_crystal.description ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.1 _exptl_crystal_grow.pdbx_details '0.2M AMPSO/KOH buffer, 0.5 - 1.0 M Ammonium sulfate, pH 9.1, VAPOR DIFFUSION, temperature 296K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2004-03-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Graphite _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1T6O _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 25.0 _reflns.number_all 5306 _reflns.number_obs 5306 _reflns.percent_possible_obs 97.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.03 _reflns_shell.percent_possible_all 96.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1T6O _refine.ls_d_res_high 2.0 _refine.ls_d_res_low 25 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I 0.0 _refine.ls_number_reflns_all 5306 _refine.ls_number_reflns_obs 5306 _refine.ls_number_reflns_R_free 307 _refine.ls_percent_reflns_obs 97.5 _refine.ls_R_factor_all 0.232 _refine.ls_R_factor_obs 0.232 _refine.ls_R_factor_R_work 0.23 _refine.ls_R_factor_R_free 0.275 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1OKS.pdb _refine.pdbx_ls_cross_valid_method 'test set omitted from all refinement' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details 'Moews & Kretsinger' _refine.solvent_model_param_bsol 300 _refine.solvent_model_param_ksol 0.85 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model 'Individual Isotropic B' _refine.B_iso_mean ? _refine.aniso_B[1][1] -2.884 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -2.884 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 5.768 _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 548 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 576 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 25 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.004827 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 0.84607 ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param ? 'X-RAY DIFFRACTION' 2 water_rep.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 1T6O _struct.title ;Nucleocapsid-binding domain of the measles virus P protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus N protein ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T6O _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'four helix bundle, Viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? SER A 15 ? SER A 460 SER A 471 1 ? 12 HELX_P HELX_P2 2 GLU A 18 ? ILE A 32 ? GLU A 474 ILE A 488 1 ? 15 HELX_P HELX_P3 3 GLY A 34 ? MET A 50 ? GLY A 490 MET A 506 1 ? 17 HELX_P HELX_P4 4 GLN C 1 ? GLY C 18 ? GLN B 486 GLY B 503 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 8 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id GLN _struct_conn.ptnr2_label_seq_id 1 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id L _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 485 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id GLN _struct_conn.ptnr2_auth_seq_id 486 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.330 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1T6O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1T6O _atom_sites.fract_transf_matrix[1][1] 0.023682 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023682 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012228 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 457 ? ? ? A . n A 1 2 GLY 2 458 458 GLY GLY A . n A 1 3 ALA 3 459 459 ALA ALA A . n A 1 4 SER 4 460 460 SER SER A . n A 1 5 ARG 5 461 461 ARG ARG A . n A 1 6 SER 6 462 462 SER SER A . n A 1 7 VAL 7 463 463 VAL VAL A . n A 1 8 ILE 8 464 464 ILE ILE A . n A 1 9 ARG 9 465 465 ARG ARG A . n A 1 10 SER 10 466 466 SER SER A . n A 1 11 ILE 11 467 467 ILE ILE A . n A 1 12 ILE 12 468 468 ILE ILE A . n A 1 13 LYS 13 469 469 LYS LYS A . n A 1 14 SER 14 470 470 SER SER A . n A 1 15 SER 15 471 471 SER SER A . n A 1 16 ARG 16 472 472 ARG ARG A . n A 1 17 LEU 17 473 473 LEU LEU A . n A 1 18 GLU 18 474 474 GLU GLU A . n A 1 19 GLU 19 475 475 GLU GLU A . n A 1 20 ASP 20 476 476 ASP ASP A . n A 1 21 ARG 21 477 477 ARG ARG A . n A 1 22 LYS 22 478 478 LYS LYS A . n A 1 23 ARG 23 479 479 ARG ARG A . n A 1 24 TYR 24 480 480 TYR TYR A . n A 1 25 LEU 25 481 481 LEU LEU A . n A 1 26 MET 26 482 482 MET MET A . n A 1 27 THR 27 483 483 THR THR A . n A 1 28 LEU 28 484 484 LEU LEU A . n A 1 29 LEU 29 485 485 LEU LEU A . n A 1 30 ASP 30 486 486 ASP ASP A . n A 1 31 ASP 31 487 487 ASP ASP A . n A 1 32 ILE 32 488 488 ILE ILE A . n A 1 33 LYS 33 489 489 LYS LYS A . n A 1 34 GLY 34 490 490 GLY GLY A . n A 1 35 ALA 35 491 491 ALA ALA A . n A 1 36 ASN 36 492 492 ASN ASN A . n A 1 37 ASP 37 493 493 ASP ASP A . n A 1 38 LEU 38 494 494 LEU LEU A . n A 1 39 ALA 39 495 495 ALA ALA A . n A 1 40 LYS 40 496 496 LYS LYS A . n A 1 41 PHE 41 497 497 PHE PHE A . n A 1 42 HIS 42 498 498 HIS HIS A . n A 1 43 GLN 43 499 499 GLN GLN A . n A 1 44 MET 44 500 500 MET MET A . n A 1 45 LEU 45 501 501 LEU LEU A . n A 1 46 MET 46 502 502 MET MET A . n A 1 47 LYS 47 503 503 LYS LYS A . n A 1 48 ILE 48 504 504 ILE ILE A . n A 1 49 ILE 49 505 505 ILE ILE A . n A 1 50 MET 50 506 506 MET MET A . n A 1 51 LYS 51 507 ? ? ? A . n B 2 1 GLY 1 478 ? ? ? L . n B 2 2 SER 2 479 ? ? ? L . n B 2 3 GLY 3 480 ? ? ? L . n B 2 4 SER 4 481 ? ? ? L . n B 2 5 GLY 5 482 ? ? ? L . n B 2 6 SER 6 483 ? ? ? L . n B 2 7 GLY 7 484 484 GLY GLY L . n B 2 8 SER 8 485 485 SER SER L . n C 3 1 GLN 1 486 486 GLN GLN B . n C 3 2 ASP 2 487 487 ASP ASP B . n C 3 3 SER 3 488 488 SER SER B . n C 3 4 ARG 4 489 489 ARG ARG B . n C 3 5 ARG 5 490 490 ARG ARG B . n C 3 6 SER 6 491 491 SER SER B . n C 3 7 ALA 7 492 492 ALA ALA B . n C 3 8 ASP 8 493 493 ASP ASP B . n C 3 9 ALA 9 494 494 ALA ALA B . n C 3 10 LEU 10 495 495 LEU LEU B . n C 3 11 LEU 11 496 496 LEU LEU B . n C 3 12 ARG 12 497 497 ARG ARG B . n C 3 13 LEU 13 498 498 LEU LEU B . n C 3 14 GLN 14 499 499 GLN GLN B . n C 3 15 ALA 15 500 500 ALA ALA B . n C 3 16 MET 16 501 501 MET MET B . n C 3 17 ALA 17 502 502 ALA ALA B . n C 3 18 GLY 18 503 503 GLY GLY B . n C 3 19 ILE 19 504 504 ILE ILE B . n C 3 20 SER 20 505 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 HOH 1 600 600 HOH HOH A . D 4 HOH 2 601 601 HOH HOH A . D 4 HOH 3 602 602 HOH HOH A . D 4 HOH 4 603 603 HOH HOH A . D 4 HOH 5 605 605 HOH HOH A . D 4 HOH 6 606 606 HOH HOH A . D 4 HOH 7 607 607 HOH HOH A . D 4 HOH 8 609 609 HOH HOH A . D 4 HOH 9 610 610 HOH HOH A . D 4 HOH 10 620 620 HOH HOH A . D 4 HOH 11 621 621 HOH HOH A . D 4 HOH 12 622 622 HOH HOH A . D 4 HOH 13 623 623 HOH HOH A . D 4 HOH 14 624 624 HOH HOH A . D 4 HOH 15 625 625 HOH HOH A . D 4 HOH 16 627 627 HOH HOH A . D 4 HOH 17 628 628 HOH HOH A . D 4 HOH 18 629 629 HOH HOH A . D 4 HOH 19 630 630 HOH HOH A . D 4 HOH 20 631 631 HOH HOH A . D 4 HOH 21 634 634 HOH HOH A . D 4 HOH 22 635 635 HOH HOH A . D 4 HOH 23 636 636 HOH HOH A . D 4 HOH 24 637 637 HOH HOH A . D 4 HOH 25 638 638 HOH HOH A . E 4 HOH 1 618 618 HOH HOH B . E 4 HOH 2 626 626 HOH HOH B . E 4 HOH 3 632 632 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 EPMR phasing . ? 3 TNT refinement . ? 4 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE Structure of a chimeric molecule encompassing amino acids 457-507 of measles P and 486-505 of measles N. They are connected by a flexible 8 amino acid linker (GS)4, which is largely disordered in the crystal structure. The asymmetric unit of the crystal contains the P moiety from one molecule (chain A) bound to the N moiety of a different molecule (Chain B). Link record between chain A and L is not provided since the part of the chain L which is linked to chain A is missing from the coordinates due to lack of electron density. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 457 ? A GLY 1 2 1 Y 1 A LYS 507 ? A LYS 51 3 1 Y 1 L GLY 478 ? B GLY 1 4 1 Y 1 L SER 479 ? B SER 2 5 1 Y 1 L GLY 480 ? B GLY 3 6 1 Y 1 L SER 481 ? B SER 4 7 1 Y 1 L GLY 482 ? B GLY 5 8 1 Y 1 L SER 483 ? B SER 6 9 1 Y 1 B SER 505 ? C SER 20 # _pdbx_entity_nonpoly.entity_id 4 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #