data_1TAM # _entry.id 1TAM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TAM pdb_00001tam 10.2210/pdb1tam/pdb WWPDB D_1000176582 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TAM _pdbx_database_status.recvd_initial_deposition_date 1996-02-07 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Matthews, S.' 1 'Barlow, P.' 2 'Clark, N.' 3 'Kingsman, S.' 4 'Kingsman, A.' 5 'Campbell, I.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Refined solution structure of p17, the HIV matrix protein.' Biochem.Soc.Trans. 23 725 729 1995 BCSTB5 UK 0300-5127 0659 ? 8654825 ? 1 'Structural Similarity between the P17 Matrix Protein of HIV-1 and Interferon-Gamma' Nature 370 666 ? 1994 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Matthews, S.' 1 ? primary 'Barlow, P.' 2 ? primary 'Clark, N.' 3 ? primary 'Kingsman, S.' 4 ? primary 'Kingsman, A.' 5 ? primary 'Campbell, I.' 6 ? 1 'Matthews, S.' 7 ? 1 'Barlow, P.' 8 ? 1 'Boyd, J.' 9 ? 1 'Barton, G.' 10 ? 1 'Russell, R.' 11 ? 1 'Mills, H.' 12 ? 1 'Cunningham, M.' 13 ? 1 'Meyers, N.' 14 ? 1 'Burns, N.' 15 ? 1 'Clark, N.' 16 ? 1 'al., et' 17 ? # _cell.entry_id 1TAM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TAM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HIV-1 MATRIX PROTEIN' _entity.formula_weight 14907.896 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HIV-1 MA, HIVP17, P17, MA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYN TVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSSQVSQNY ; _entity_poly.pdbx_seq_one_letter_code_can ;MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYN TVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSSQVSQNY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ALA n 1 4 ARG n 1 5 ALA n 1 6 SER n 1 7 VAL n 1 8 LEU n 1 9 SER n 1 10 GLY n 1 11 GLY n 1 12 GLU n 1 13 LEU n 1 14 ASP n 1 15 ARG n 1 16 TRP n 1 17 GLU n 1 18 LYS n 1 19 ILE n 1 20 ARG n 1 21 LEU n 1 22 ARG n 1 23 PRO n 1 24 GLY n 1 25 GLY n 1 26 LYS n 1 27 LYS n 1 28 LYS n 1 29 TYR n 1 30 LYS n 1 31 LEU n 1 32 LYS n 1 33 HIS n 1 34 ILE n 1 35 VAL n 1 36 TRP n 1 37 ALA n 1 38 SER n 1 39 ARG n 1 40 GLU n 1 41 LEU n 1 42 GLU n 1 43 ARG n 1 44 PHE n 1 45 ALA n 1 46 VAL n 1 47 ASN n 1 48 PRO n 1 49 GLY n 1 50 LEU n 1 51 LEU n 1 52 GLU n 1 53 THR n 1 54 SER n 1 55 GLU n 1 56 GLY n 1 57 CYS n 1 58 ARG n 1 59 GLN n 1 60 ILE n 1 61 LEU n 1 62 GLY n 1 63 GLN n 1 64 LEU n 1 65 GLN n 1 66 PRO n 1 67 SER n 1 68 LEU n 1 69 GLN n 1 70 THR n 1 71 GLY n 1 72 SER n 1 73 GLU n 1 74 GLU n 1 75 LEU n 1 76 ARG n 1 77 SER n 1 78 LEU n 1 79 TYR n 1 80 ASN n 1 81 THR n 1 82 VAL n 1 83 ALA n 1 84 THR n 1 85 LEU n 1 86 TYR n 1 87 CYS n 1 88 VAL n 1 89 HIS n 1 90 GLN n 1 91 ARG n 1 92 ILE n 1 93 GLU n 1 94 ILE n 1 95 LYS n 1 96 ASP n 1 97 THR n 1 98 LYS n 1 99 GLU n 1 100 ALA n 1 101 LEU n 1 102 ASP n 1 103 LYS n 1 104 ILE n 1 105 GLU n 1 106 GLU n 1 107 GLU n 1 108 GLN n 1 109 ASN n 1 110 LYS n 1 111 SER n 1 112 LYS n 1 113 LYS n 1 114 LYS n 1 115 ALA n 1 116 GLN n 1 117 GLN n 1 118 ALA n 1 119 ALA n 1 120 ALA n 1 121 ASP n 1 122 THR n 1 123 GLY n 1 124 HIS n 1 125 SER n 1 126 SER n 1 127 GLN n 1 128 VAL n 1 129 SER n 1 130 GLN n 1 131 ASN n 1 132 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Human immunodeficiency virus 1' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HIV-1 M:B_HXB2R' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11706 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1H2 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04585 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;GARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT VATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEE KAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTS TLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETL LVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHT ARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDK ELYPLTSLRSLFGNDPSSQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TAM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04585 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 132 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1TAM _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 126 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P04585 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 125 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 126 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1TAM _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1TAM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1TAM _struct.title 'HUMAN IMMUNODEFICIENCY VIRUS, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TAM _struct_keywords.pdbx_keywords 'MATRIX PROTEIN' _struct_keywords.text 'AIDS, CORE PROTEIN, POLYPROTEIN, MYRISTYLATION, PHOSPHORYLATION, MATRIX PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 11 ? LYS A 18 ? GLY A 11 LYS A 18 1 ? 8 HELX_P HELX_P2 2 LEU A 31 ? ALA A 45 ? LEU A 31 ALA A 45 1 ? 15 HELX_P HELX_P3 3 SER A 54 ? GLN A 69 ? SER A 54 GLN A 69 1 ? 16 HELX_P HELX_P4 4 SER A 72 ? GLN A 90 ? SER A 72 GLN A 90 1 ? 19 HELX_P HELX_P5 5 THR A 97 ? LYS A 112 ? THR A 97 LYS A 112 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 20 ? LEU A 21 ? ARG A 20 LEU A 21 A 2 LYS A 27 ? LYS A 28 ? LYS A 27 LYS A 28 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 21 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 21 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 27 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 27 # _database_PDB_matrix.entry_id 1TAM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TAM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 THR 122 122 ? ? ? A . n A 1 123 GLY 123 123 ? ? ? A . n A 1 124 HIS 124 124 ? ? ? A . n A 1 125 SER 125 125 ? ? ? A . n A 1 126 SER 126 126 ? ? ? A . n A 1 127 GLN 127 127 ? ? ? A . n A 1 128 VAL 128 128 ? ? ? A . n A 1 129 SER 129 129 ? ? ? A . n A 1 130 GLN 130 130 ? ? ? A . n A 1 131 ASN 131 131 ? ? ? A . n A 1 132 TYR 132 132 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-07-11 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 5 ? ? -92.93 49.06 2 1 VAL A 7 ? ? -98.14 34.71 3 1 LEU A 8 ? ? 61.36 116.32 4 1 SER A 9 ? ? -158.63 -44.41 5 1 VAL A 46 ? ? 38.00 44.46 6 1 ASN A 47 ? ? 177.74 -55.81 7 1 ILE A 92 ? ? 91.78 2.19 8 1 GLU A 93 ? ? -91.54 47.69 9 1 LYS A 113 ? ? -100.47 65.36 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 4 ? ? 0.314 'SIDE CHAIN' 2 1 ARG A 15 ? ? 0.184 'SIDE CHAIN' 3 1 ARG A 20 ? ? 0.224 'SIDE CHAIN' 4 1 ARG A 22 ? ? 0.239 'SIDE CHAIN' 5 1 ARG A 39 ? ? 0.293 'SIDE CHAIN' 6 1 ARG A 43 ? ? 0.290 'SIDE CHAIN' 7 1 ARG A 58 ? ? 0.312 'SIDE CHAIN' 8 1 ARG A 76 ? ? 0.244 'SIDE CHAIN' 9 1 ARG A 91 ? ? 0.181 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 121 ? A ASP 121 2 1 Y 1 A THR 122 ? A THR 122 3 1 Y 1 A GLY 123 ? A GLY 123 4 1 Y 1 A HIS 124 ? A HIS 124 5 1 Y 1 A SER 125 ? A SER 125 6 1 Y 1 A SER 126 ? A SER 126 7 1 Y 1 A GLN 127 ? A GLN 127 8 1 Y 1 A VAL 128 ? A VAL 128 9 1 Y 1 A SER 129 ? A SER 129 10 1 Y 1 A GLN 130 ? A GLN 130 11 1 Y 1 A ASN 131 ? A ASN 131 12 1 Y 1 A TYR 132 ? A TYR 132 #