data_1TAW # _entry.id 1TAW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TAW pdb_00001taw 10.2210/pdb1taw/pdb WWPDB D_1000176590 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TAW _pdbx_database_status.recvd_initial_deposition_date 1996-12-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hynes, T.R.' 1 'Kossiakoff, A.A.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Crystal structures of bovine chymotrypsin and trypsin complexed to the inhibitor domain of Alzheimer's amyloid beta-protein precursor (APPI) and basic pancreatic trypsin inhibitor (BPTI): engineering of inhibitors with altered specificities. ; 'Protein Sci.' 6 1806 1824 1997 PRCIEI US 0961-8368 0795 ? 9300481 ? 1 ;X-Ray Crystal Structure of the Protease Inhibitor Domain of Alzheimer'S Amyloid Beta-Protein Precursor ; Biochemistry 29 10018 ? 1990 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Scheidig, A.J.' 1 ? primary 'Hynes, T.R.' 2 ? primary 'Pelletier, L.A.' 3 ? primary 'Wells, J.A.' 4 ? primary 'Kossiakoff, A.A.' 5 ? 1 'Hynes, T.R.' 6 ? 1 'Randal, M.' 7 ? 1 'Kennedy, L.A.' 8 ? 1 'Eigenbrot, C.' 9 ? 1 'Kossiakoff, A.A.' 10 ? # _cell.entry_id 1TAW _cell.length_a 94.050 _cell.length_b 49.850 _cell.length_c 68.800 _cell.angle_alpha 90.00 _cell.angle_beta 96.31 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TAW _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat TRYPSIN 23310.303 1 3.4.21.4 ? ? ? 2 polymer man ;PROTEASE INHIBITOR DOMAIN OF ALZHEIMER'S AMYLOID BETA-PROTEIN PRECURSOR ; 6420.147 1 ? ? ;RESIDUES 289 - 342 OF ALZHEIMER'S AMYLOID BETA-PROTEIN PRECURSOR ; ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 153 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name APPI # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSTSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSTSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; A ? 2 'polypeptide(L)' no no VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSA VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLY n 1 9 ALA n 1 10 ASN n 1 11 THR n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 VAL n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 ILE n 1 66 SER n 1 67 ALA n 1 68 SER n 1 69 LYS n 1 70 SER n 1 71 ILE n 1 72 VAL n 1 73 HIS n 1 74 PRO n 1 75 SER n 1 76 TYR n 1 77 ASN n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 LYS n 1 92 SER n 1 93 ALA n 1 94 ALA n 1 95 SER n 1 96 LEU n 1 97 ASN n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 THR n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 SER n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LYS n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 SER n 1 131 TYR n 1 132 PRO n 1 133 ASP n 1 134 VAL n 1 135 LEU n 1 136 LYS n 1 137 CYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 ILE n 1 143 LEU n 1 144 SER n 1 145 THR n 1 146 SER n 1 147 SER n 1 148 CYS n 1 149 LYS n 1 150 SER n 1 151 ALA n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 GLN n 1 156 ILE n 1 157 THR n 1 158 SER n 1 159 ASN n 1 160 MET n 1 161 PHE n 1 162 CYS n 1 163 ALA n 1 164 GLY n 1 165 TYR n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 SER n 1 185 GLY n 1 186 LYS n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 SER n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 GLN n 1 200 LYS n 1 201 ASN n 1 202 LYS n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 SER n 1 215 TRP n 1 216 ILE n 1 217 LYS n 1 218 GLN n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 SER n 1 223 ASN n 2 1 VAL n 2 2 ARG n 2 3 GLU n 2 4 VAL n 2 5 CYS n 2 6 SER n 2 7 GLU n 2 8 GLN n 2 9 ALA n 2 10 GLU n 2 11 THR n 2 12 GLY n 2 13 PRO n 2 14 CYS n 2 15 ARG n 2 16 ALA n 2 17 MET n 2 18 ILE n 2 19 SER n 2 20 ARG n 2 21 TRP n 2 22 TYR n 2 23 PHE n 2 24 ASP n 2 25 VAL n 2 26 THR n 2 27 GLU n 2 28 GLY n 2 29 LYS n 2 30 CYS n 2 31 ALA n 2 32 PRO n 2 33 PHE n 2 34 PHE n 2 35 TYR n 2 36 GLY n 2 37 GLY n 2 38 CYS n 2 39 GLY n 2 40 GLY n 2 41 ASN n 2 42 ARG n 2 43 ASN n 2 44 ASN n 2 45 PHE n 2 46 ASP n 2 47 THR n 2 48 GLU n 2 49 GLU n 2 50 TYR n 2 51 CYS n 2 52 MET n 2 53 ALA n 2 54 VAL n 2 55 CYS n 2 56 GLY n 2 57 SER n 2 58 ALA n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene A4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PANCREATIC _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene A4 _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 27C7 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PA4G32R _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name cattle _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus Bos _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ PANCREATIC _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP TRY1_BOVIN 1 P00760 1 ;FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKA PILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTI ASN ; ? 2 UNP A4_HUMAN 2 P05067 1 ;MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPEL QITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSE KSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFF YGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEA KHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPV DARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN ; ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1TAW A 1 ? 223 ? P00760 21 ? 243 ? 16 245 2 2 1TAW B 1 ? 58 ? P05067 287 ? 344 ? 1 58 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1TAW _struct_ref_seq_dif.mon_id THR _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 145 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00760 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 165 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 165 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1TAW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.74 _exptl_crystal.density_percent_sol 54.36 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6.5' # _diffrn.id 1 _diffrn.ambient_temp 277 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector DIFFRACTOMETER _diffrn_detector.type 'ENRAF-NONIUS FAST' _diffrn_detector.pdbx_collection_date 1992-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1TAW _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.80 _reflns.number_obs 22374 _reflns.number_all ? _reflns.percent_possible_obs 76.6 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 10.0 _reflns.B_iso_Wilson_estimate 31.50 _reflns.pdbx_redundancy 3.0 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 2.0 _reflns_shell.percent_possible_all 79.3 _reflns_shell.Rmerge_I_obs 0.08 _reflns_shell.pdbx_Rsym_value 0.25 _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1TAW _refine.ls_number_reflns_obs 22374 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0. _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs 76.6 _refine.ls_R_factor_obs 0.184 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.184 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 39.23 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 2PTC' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1TAW _refine_analyze.Luzzati_coordinate_error_obs 0.23 _refine_analyze.Luzzati_sigma_a_obs 0.32 _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2044 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 153 _refine_hist.number_atoms_total 2198 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.457 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.98 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.302 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 PARAM19.SOL TOPH19.SOL 'X-RAY DIFFRACTION' 3 PARAM19.ION TOPH19.ION 'X-RAY DIFFRACTION' # _struct.entry_id 1TAW _struct.title 'BOVINE TRYPSIN COMPLEXED TO APPI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TAW _struct_keywords.pdbx_keywords 'COMPLEX (SERINE PROTEASE/INHIBITOR)' _struct_keywords.text 'SERINE PROTEASE, KUNITZ TYPE INHIBITOR, COMPLEX, PROTEASE-SUBSTRATE INTERACTIONS, COMPLEX (SERINE PROTEASE-INHIBITOR) COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 39 ? CYS A 41 ? ALA A 56 CYS A 58 5 ? 3 HELX_P HELX_P2 2 THR A 145 ? ALA A 151 ? THR A 165 ALA A 171 1 ? 7 HELX_P HELX_P3 3 VAL A 209 ? ALA A 221 ? VAL A 231 ALA A 243 5 ? 13 HELX_P HELX_P4 4 VAL B 4 ? SER B 6 ? VAL B 4 SER B 6 5 ? 3 HELX_P HELX_P5 5 GLU B 48 ? VAL B 54 ? GLU B 48 VAL B 54 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf7 disulf ? ? B CYS 5 SG ? ? ? 1_555 B CYS 55 SG ? ? B CYS 5 B CYS 55 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf8 disulf ? ? B CYS 14 SG ? ? ? 1_555 B CYS 38 SG ? ? B CYS 14 B CYS 38 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf9 disulf ? ? B CYS 30 SG ? ? ? 1_555 B CYS 51 SG ? ? B CYS 30 B CYS 51 1_555 ? ? ? ? ? ? ? 2.008 ? ? metalc1 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 70 A CA 246 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc2 metalc ? ? A ASN 54 O ? ? ? 1_555 C CA . CA ? ? A ASN 72 A CA 246 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc3 metalc ? ? A VAL 57 O ? ? ? 1_555 C CA . CA ? ? A VAL 75 A CA 246 1_555 ? ? ? ? ? ? ? 2.182 ? ? metalc4 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 80 A CA 246 1_555 ? ? ? ? ? ? ? 2.476 ? ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 246 A HOH 275 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 246 A HOH 322 1_555 ? ? ? ? ? ? ? 2.369 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? C ? 4 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 63 ? SER A 66 ? GLN A 81 SER A 84 A 2 GLN A 47 ? LEU A 50 ? GLN A 64 LEU A 67 A 3 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 A 4 HIS A 23 ? ASN A 31 ? HIS A 40 ASN A 48 A 5 TRP A 34 ? SER A 37 ? TRP A 51 SER A 54 A 6 MET A 86 ? LEU A 90 ? MET A 104 LEU A 108 A 7 ALA A 67 ? VAL A 72 ? ALA A 85 VAL A 90 B 1 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 B 2 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 C 1 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 C 2 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 C 3 LYS A 186 ? TRP A 193 ? LYS A 204 TRP A 215 C 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 D 1 ILE B 18 ? ASP B 24 ? ILE B 18 ASP B 24 D 2 LYS B 29 ? TYR B 35 ? LYS B 29 TYR B 35 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 63 ? O GLN A 81 N LEU A 50 ? N LEU A 67 A 2 3 O GLN A 47 ? O GLN A 64 N ASN A 19 ? N ASN A 34 A 3 4 O VAL A 16 ? O VAL A 31 N GLY A 27 ? N GLY A 44 A 4 5 O SER A 28 ? O SER A 45 N VAL A 36 ? N VAL A 53 A 5 6 O VAL A 35 ? O VAL A 52 N ILE A 88 ? N ILE A 106 A 6 7 O LEU A 87 ? O LEU A 105 N ILE A 71 ? N ILE A 89 B 1 2 O CYS A 116 ? O CYS A 136 N ALA A 140 ? N ALA A 160 C 1 2 O PHE A 161 ? O PHE A 181 N TYR A 206 ? N TYR A 228 C 2 3 O VAL A 205 ? O VAL A 227 N TRP A 193 ? N TRP A 215 C 3 4 O LYS A 186 ? O LYS A 204 N CYS A 183 ? N CYS A 201 D 1 2 O ILE B 18 ? O ILE B 18 N TYR B 35 ? N TYR B 35 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 246 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 246' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 52 ? GLU A 70 . ? 1_555 ? 2 AC1 6 ASN A 54 ? ASN A 72 . ? 1_555 ? 3 AC1 6 VAL A 57 ? VAL A 75 . ? 1_555 ? 4 AC1 6 GLU A 62 ? GLU A 80 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 275 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 322 . ? 1_555 ? # _database_PDB_matrix.entry_id 1TAW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TAW _atom_sites.fract_transf_matrix[1][1] 0.010633 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001176 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020060 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014623 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 TYR 5 20 20 TYR TYR A . n A 1 6 THR 6 21 21 THR THR A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 GLY 8 23 23 GLY GLY A . n A 1 9 ALA 9 24 24 ALA ALA A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 THR 11 26 26 THR THR A . n A 1 12 VAL 12 27 27 VAL VAL A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ASN 19 34 34 ASN ASN A . n A 1 20 SER 20 37 37 SER SER A . n A 1 21 GLY 21 38 38 GLY GLY A . n A 1 22 TYR 22 39 39 TYR TYR A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 CYS 25 42 42 CYS CYS A . n A 1 26 GLY 26 43 43 GLY GLY A . n A 1 27 GLY 27 44 44 GLY GLY A . n A 1 28 SER 28 45 45 SER SER A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ASN 31 48 48 ASN ASN A . n A 1 32 SER 32 49 49 SER SER A . n A 1 33 GLN 33 50 50 GLN GLN A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 VAL 36 53 53 VAL VAL A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 HIS 40 57 57 HIS HIS A . n A 1 41 CYS 41 58 58 CYS CYS A . n A 1 42 TYR 42 59 59 TYR TYR A . n A 1 43 LYS 43 60 60 LYS LYS A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 GLY 45 62 62 GLY GLY A . n A 1 46 ILE 46 63 63 ILE ILE A . n A 1 47 GLN 47 64 64 GLN GLN A . n A 1 48 VAL 48 65 65 VAL VAL A . n A 1 49 ARG 49 66 66 ARG ARG A . n A 1 50 LEU 50 67 67 LEU LEU A . n A 1 51 GLY 51 69 69 GLY GLY A . n A 1 52 GLU 52 70 70 GLU GLU A . n A 1 53 ASP 53 71 71 ASP ASP A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 ASN 56 74 74 ASN ASN A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 VAL 58 76 76 VAL VAL A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 GLY 60 78 78 GLY GLY A . n A 1 61 ASN 61 79 79 ASN ASN A . n A 1 62 GLU 62 80 80 GLU GLU A . n A 1 63 GLN 63 81 81 GLN GLN A . n A 1 64 PHE 64 82 82 PHE PHE A . n A 1 65 ILE 65 83 83 ILE ILE A . n A 1 66 SER 66 84 84 SER SER A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 SER 68 86 86 SER SER A . n A 1 69 LYS 69 87 87 LYS LYS A . n A 1 70 SER 70 88 88 SER SER A . n A 1 71 ILE 71 89 89 ILE ILE A . n A 1 72 VAL 72 90 90 VAL VAL A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 PRO 74 92 92 PRO PRO A . n A 1 75 SER 75 93 93 SER SER A . n A 1 76 TYR 76 94 94 TYR TYR A . n A 1 77 ASN 77 95 95 ASN ASN A . n A 1 78 SER 78 96 96 SER SER A . n A 1 79 ASN 79 97 97 ASN ASN A . n A 1 80 THR 80 98 98 THR THR A . n A 1 81 LEU 81 99 99 LEU LEU A . n A 1 82 ASN 82 100 100 ASN ASN A . n A 1 83 ASN 83 101 101 ASN ASN A . n A 1 84 ASP 84 102 102 ASP ASP A . n A 1 85 ILE 85 103 103 ILE ILE A . n A 1 86 MET 86 104 104 MET MET A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 ILE 88 106 106 ILE ILE A . n A 1 89 LYS 89 107 107 LYS LYS A . n A 1 90 LEU 90 108 108 LEU LEU A . n A 1 91 LYS 91 109 109 LYS LYS A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 ALA 93 111 111 ALA ALA A . n A 1 94 ALA 94 112 112 ALA ALA A . n A 1 95 SER 95 113 113 SER SER A . n A 1 96 LEU 96 114 114 LEU LEU A . n A 1 97 ASN 97 115 115 ASN ASN A . n A 1 98 SER 98 116 116 SER SER A . n A 1 99 ARG 99 117 117 ARG ARG A . n A 1 100 VAL 100 118 118 VAL VAL A . n A 1 101 ALA 101 119 119 ALA ALA A . n A 1 102 SER 102 120 120 SER SER A . n A 1 103 ILE 103 121 121 ILE ILE A . n A 1 104 SER 104 122 122 SER SER A . n A 1 105 LEU 105 123 123 LEU LEU A . n A 1 106 PRO 106 124 124 PRO PRO A . n A 1 107 THR 107 125 125 THR THR A . n A 1 108 SER 108 127 127 SER SER A . n A 1 109 CYS 109 128 128 CYS CYS A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 SER 111 130 130 SER SER A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 GLY 113 133 133 GLY GLY A . n A 1 114 THR 114 134 134 THR THR A . n A 1 115 GLN 115 135 135 GLN GLN A . n A 1 116 CYS 116 136 136 CYS CYS A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 TRP 121 141 141 TRP TRP A . n A 1 122 GLY 122 142 142 GLY GLY A . n A 1 123 ASN 123 143 143 ASN ASN A . n A 1 124 THR 124 144 144 THR THR A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 SER 126 146 146 SER SER A . n A 1 127 SER 127 147 147 SER SER A . n A 1 128 GLY 128 148 148 GLY GLY A . n A 1 129 THR 129 149 149 THR THR A . n A 1 130 SER 130 150 150 SER SER A . n A 1 131 TYR 131 151 151 TYR TYR A . n A 1 132 PRO 132 152 152 PRO PRO A . n A 1 133 ASP 133 153 153 ASP ASP A . n A 1 134 VAL 134 154 154 VAL VAL A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 LYS 136 156 156 LYS LYS A . n A 1 137 CYS 137 157 157 CYS CYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 LYS 139 159 159 LYS LYS A . n A 1 140 ALA 140 160 160 ALA ALA A . n A 1 141 PRO 141 161 161 PRO PRO A . n A 1 142 ILE 142 162 162 ILE ILE A . n A 1 143 LEU 143 163 163 LEU LEU A . n A 1 144 SER 144 164 164 SER SER A . n A 1 145 THR 145 165 165 THR THR A . n A 1 146 SER 146 166 166 SER SER A . n A 1 147 SER 147 167 167 SER SER A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 LYS 149 169 169 LYS LYS A . n A 1 150 SER 150 170 170 SER SER A . n A 1 151 ALA 151 171 171 ALA ALA A . n A 1 152 TYR 152 172 172 TYR TYR A . n A 1 153 PRO 153 173 173 PRO PRO A . n A 1 154 GLY 154 174 174 GLY GLY A . n A 1 155 GLN 155 175 175 GLN GLN A . n A 1 156 ILE 156 176 176 ILE ILE A . n A 1 157 THR 157 177 177 THR THR A . n A 1 158 SER 158 178 178 SER SER A . n A 1 159 ASN 159 179 179 ASN ASN A . n A 1 160 MET 160 180 180 MET MET A . n A 1 161 PHE 161 181 181 PHE PHE A . n A 1 162 CYS 162 182 182 CYS CYS A . n A 1 163 ALA 163 183 183 ALA ALA A . n A 1 164 GLY 164 184 184 GLY GLY A A n A 1 165 TYR 165 184 184 TYR TYR A . n A 1 166 LEU 166 185 185 LEU LEU A . n A 1 167 GLU 167 186 186 GLU GLU A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 GLY 169 188 188 GLY GLY A A n A 1 170 LYS 170 188 188 LYS LYS A . n A 1 171 ASP 171 189 189 ASP ASP A . n A 1 172 SER 172 190 190 SER SER A . n A 1 173 CYS 173 191 191 CYS CYS A . n A 1 174 GLN 174 192 192 GLN GLN A . n A 1 175 GLY 175 193 193 GLY GLY A . n A 1 176 ASP 176 194 194 ASP ASP A . n A 1 177 SER 177 195 195 SER SER A . n A 1 178 GLY 178 196 196 GLY GLY A . n A 1 179 GLY 179 197 197 GLY GLY A . n A 1 180 PRO 180 198 198 PRO PRO A . n A 1 181 VAL 181 199 199 VAL VAL A . n A 1 182 VAL 182 200 200 VAL VAL A . n A 1 183 CYS 183 201 201 CYS CYS A . n A 1 184 SER 184 202 202 SER SER A . n A 1 185 GLY 185 203 203 GLY GLY A . n A 1 186 LYS 186 204 204 LYS LYS A . n A 1 187 LEU 187 209 209 LEU LEU A . n A 1 188 GLN 188 210 210 GLN GLN A . n A 1 189 GLY 189 211 211 GLY GLY A . n A 1 190 ILE 190 212 212 ILE ILE A . n A 1 191 VAL 191 213 213 VAL VAL A . n A 1 192 SER 192 214 214 SER SER A . n A 1 193 TRP 193 215 215 TRP TRP A . n A 1 194 GLY 194 216 216 GLY GLY A . n A 1 195 SER 195 217 217 SER SER A . n A 1 196 GLY 196 219 219 GLY GLY A . n A 1 197 CYS 197 220 220 CYS CYS A . n A 1 198 ALA 198 221 221 ALA ALA A A n A 1 199 GLN 199 221 221 GLN GLN A . n A 1 200 LYS 200 222 222 LYS LYS A . n A 1 201 ASN 201 223 223 ASN ASN A . n A 1 202 LYS 202 224 224 LYS LYS A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 GLY 204 226 226 GLY GLY A . n A 1 205 VAL 205 227 227 VAL VAL A . n A 1 206 TYR 206 228 228 TYR TYR A . n A 1 207 THR 207 229 229 THR THR A . n A 1 208 LYS 208 230 230 LYS LYS A . n A 1 209 VAL 209 231 231 VAL VAL A . n A 1 210 CYS 210 232 232 CYS CYS A . n A 1 211 ASN 211 233 233 ASN ASN A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 VAL 213 235 235 VAL VAL A . n A 1 214 SER 214 236 236 SER SER A . n A 1 215 TRP 215 237 237 TRP TRP A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 LYS 217 239 239 LYS LYS A . n A 1 218 GLN 218 240 240 GLN GLN A . n A 1 219 THR 219 241 241 THR THR A . n A 1 220 ILE 220 242 242 ILE ILE A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 SER 222 244 244 SER SER A . n A 1 223 ASN 223 245 245 ASN ASN A . n B 2 1 VAL 1 1 ? ? ? B . n B 2 2 ARG 2 2 ? ? ? B . n B 2 3 GLU 3 3 3 GLU GLU B . n B 2 4 VAL 4 4 4 VAL VAL B . n B 2 5 CYS 5 5 5 CYS CYS B . n B 2 6 SER 6 6 6 SER SER B . n B 2 7 GLU 7 7 7 GLU GLU B . n B 2 8 GLN 8 8 8 GLN GLN B . n B 2 9 ALA 9 9 9 ALA ALA B . n B 2 10 GLU 10 10 10 GLU GLU B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 GLY 12 12 12 GLY GLY B . n B 2 13 PRO 13 13 13 PRO PRO B . n B 2 14 CYS 14 14 14 CYS CYS B . n B 2 15 ARG 15 15 15 ARG ARG B . n B 2 16 ALA 16 16 16 ALA ALA B . n B 2 17 MET 17 17 17 MET MET B . n B 2 18 ILE 18 18 18 ILE ILE B . n B 2 19 SER 19 19 19 SER SER B . n B 2 20 ARG 20 20 20 ARG ARG B . n B 2 21 TRP 21 21 21 TRP TRP B . n B 2 22 TYR 22 22 22 TYR TYR B . n B 2 23 PHE 23 23 23 PHE PHE B . n B 2 24 ASP 24 24 24 ASP ASP B . n B 2 25 VAL 25 25 25 VAL VAL B . n B 2 26 THR 26 26 26 THR THR B . n B 2 27 GLU 27 27 27 GLU GLU B . n B 2 28 GLY 28 28 28 GLY GLY B . n B 2 29 LYS 29 29 29 LYS LYS B . n B 2 30 CYS 30 30 30 CYS CYS B . n B 2 31 ALA 31 31 31 ALA ALA B . n B 2 32 PRO 32 32 32 PRO PRO B . n B 2 33 PHE 33 33 33 PHE PHE B . n B 2 34 PHE 34 34 34 PHE PHE B . n B 2 35 TYR 35 35 35 TYR TYR B . n B 2 36 GLY 36 36 36 GLY GLY B . n B 2 37 GLY 37 37 37 GLY GLY B . n B 2 38 CYS 38 38 38 CYS CYS B . n B 2 39 GLY 39 39 39 GLY GLY B . n B 2 40 GLY 40 40 40 GLY GLY B . n B 2 41 ASN 41 41 41 ASN ASN B . n B 2 42 ARG 42 42 42 ARG ARG B . n B 2 43 ASN 43 43 43 ASN ASN B . n B 2 44 ASN 44 44 44 ASN ASN B . n B 2 45 PHE 45 45 45 PHE PHE B . n B 2 46 ASP 46 46 46 ASP ASP B . n B 2 47 THR 47 47 47 THR THR B . n B 2 48 GLU 48 48 48 GLU GLU B . n B 2 49 GLU 49 49 49 GLU GLU B . n B 2 50 TYR 50 50 50 TYR TYR B . n B 2 51 CYS 51 51 51 CYS CYS B . n B 2 52 MET 52 52 52 MET MET B . n B 2 53 ALA 53 53 53 ALA ALA B . n B 2 54 VAL 54 54 54 VAL VAL B . n B 2 55 CYS 55 55 55 CYS CYS B . n B 2 56 GLY 56 56 56 GLY GLY B . n B 2 57 SER 57 57 ? ? ? B . n B 2 58 ALA 58 58 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 246 101 CA CA A . D 4 HOH 1 247 7 HOH HOH A . D 4 HOH 2 248 8 HOH HOH A . D 4 HOH 3 249 9 HOH HOH A . D 4 HOH 4 250 10 HOH HOH A . D 4 HOH 5 251 11 HOH HOH A . D 4 HOH 6 252 12 HOH HOH A . D 4 HOH 7 253 13 HOH HOH A . D 4 HOH 8 254 14 HOH HOH A . D 4 HOH 9 255 15 HOH HOH A . D 4 HOH 10 256 16 HOH HOH A . D 4 HOH 11 257 17 HOH HOH A . D 4 HOH 12 258 18 HOH HOH A . D 4 HOH 13 259 19 HOH HOH A . D 4 HOH 14 260 20 HOH HOH A . D 4 HOH 15 261 21 HOH HOH A . D 4 HOH 16 262 22 HOH HOH A . D 4 HOH 17 263 23 HOH HOH A . D 4 HOH 18 264 24 HOH HOH A . D 4 HOH 19 265 25 HOH HOH A . D 4 HOH 20 266 26 HOH HOH A . D 4 HOH 21 267 27 HOH HOH A . D 4 HOH 22 268 28 HOH HOH A . D 4 HOH 23 269 29 HOH HOH A . D 4 HOH 24 270 30 HOH HOH A . D 4 HOH 25 271 31 HOH HOH A . D 4 HOH 26 272 32 HOH HOH A . D 4 HOH 27 273 33 HOH HOH A . D 4 HOH 28 274 34 HOH HOH A . D 4 HOH 29 275 35 HOH HOH A . D 4 HOH 30 276 36 HOH HOH A . D 4 HOH 31 277 37 HOH HOH A . D 4 HOH 32 278 38 HOH HOH A . D 4 HOH 33 279 39 HOH HOH A . D 4 HOH 34 280 41 HOH HOH A . D 4 HOH 35 281 45 HOH HOH A . D 4 HOH 36 282 46 HOH HOH A . D 4 HOH 37 283 47 HOH HOH A . D 4 HOH 38 284 48 HOH HOH A . D 4 HOH 39 285 49 HOH HOH A . D 4 HOH 40 286 50 HOH HOH A . D 4 HOH 41 287 51 HOH HOH A . D 4 HOH 42 288 52 HOH HOH A . D 4 HOH 43 289 53 HOH HOH A . D 4 HOH 44 290 54 HOH HOH A . D 4 HOH 45 291 55 HOH HOH A . D 4 HOH 46 292 56 HOH HOH A . D 4 HOH 47 293 57 HOH HOH A . D 4 HOH 48 294 58 HOH HOH A . D 4 HOH 49 295 59 HOH HOH A . D 4 HOH 50 296 60 HOH HOH A . D 4 HOH 51 297 61 HOH HOH A . D 4 HOH 52 298 63 HOH HOH A . D 4 HOH 53 299 64 HOH HOH A . D 4 HOH 54 300 65 HOH HOH A . D 4 HOH 55 301 66 HOH HOH A . D 4 HOH 56 302 67 HOH HOH A . D 4 HOH 57 303 68 HOH HOH A . D 4 HOH 58 304 69 HOH HOH A . D 4 HOH 59 305 70 HOH HOH A . D 4 HOH 60 306 71 HOH HOH A . D 4 HOH 61 307 72 HOH HOH A . D 4 HOH 62 308 73 HOH HOH A . D 4 HOH 63 309 74 HOH HOH A . D 4 HOH 64 310 75 HOH HOH A . D 4 HOH 65 311 76 HOH HOH A . D 4 HOH 66 312 77 HOH HOH A . D 4 HOH 67 313 78 HOH HOH A . D 4 HOH 68 314 79 HOH HOH A . D 4 HOH 69 315 80 HOH HOH A . D 4 HOH 70 316 81 HOH HOH A . D 4 HOH 71 317 82 HOH HOH A . D 4 HOH 72 318 83 HOH HOH A . D 4 HOH 73 319 84 HOH HOH A . D 4 HOH 74 320 85 HOH HOH A . D 4 HOH 75 321 86 HOH HOH A . D 4 HOH 76 322 87 HOH HOH A . D 4 HOH 77 323 88 HOH HOH A . D 4 HOH 78 324 89 HOH HOH A . D 4 HOH 79 325 90 HOH HOH A . D 4 HOH 80 326 91 HOH HOH A . D 4 HOH 81 327 92 HOH HOH A . D 4 HOH 82 328 93 HOH HOH A . D 4 HOH 83 329 95 HOH HOH A . D 4 HOH 84 330 96 HOH HOH A . D 4 HOH 85 331 97 HOH HOH A . D 4 HOH 86 332 102 HOH HOH A . D 4 HOH 87 333 103 HOH HOH A . D 4 HOH 88 334 104 HOH HOH A . D 4 HOH 89 335 105 HOH HOH A . D 4 HOH 90 336 106 HOH HOH A . D 4 HOH 91 337 107 HOH HOH A . D 4 HOH 92 338 108 HOH HOH A . D 4 HOH 93 339 109 HOH HOH A . D 4 HOH 94 340 110 HOH HOH A . D 4 HOH 95 341 111 HOH HOH A . D 4 HOH 96 342 112 HOH HOH A . D 4 HOH 97 343 113 HOH HOH A . D 4 HOH 98 344 114 HOH HOH A . D 4 HOH 99 345 115 HOH HOH A . D 4 HOH 100 346 118 HOH HOH A . D 4 HOH 101 347 119 HOH HOH A . D 4 HOH 102 348 120 HOH HOH A . D 4 HOH 103 349 121 HOH HOH A . D 4 HOH 104 350 123 HOH HOH A . D 4 HOH 105 351 124 HOH HOH A . D 4 HOH 106 352 125 HOH HOH A . D 4 HOH 107 353 126 HOH HOH A . D 4 HOH 108 354 128 HOH HOH A . D 4 HOH 109 355 130 HOH HOH A . D 4 HOH 110 356 133 HOH HOH A . D 4 HOH 111 357 134 HOH HOH A . D 4 HOH 112 358 135 HOH HOH A . D 4 HOH 113 359 136 HOH HOH A . D 4 HOH 114 360 137 HOH HOH A . D 4 HOH 115 361 139 HOH HOH A . D 4 HOH 116 362 140 HOH HOH A . D 4 HOH 117 363 141 HOH HOH A . D 4 HOH 118 364 142 HOH HOH A . D 4 HOH 119 365 143 HOH HOH A . D 4 HOH 120 366 144 HOH HOH A . D 4 HOH 121 367 145 HOH HOH A . D 4 HOH 122 368 147 HOH HOH A . D 4 HOH 123 369 148 HOH HOH A . D 4 HOH 124 370 150 HOH HOH A . D 4 HOH 125 371 151 HOH HOH A . D 4 HOH 126 372 153 HOH HOH A . E 4 HOH 1 59 1 HOH HOH B . E 4 HOH 2 60 2 HOH HOH B . E 4 HOH 3 61 3 HOH HOH B . E 4 HOH 4 62 4 HOH HOH B . E 4 HOH 5 63 5 HOH HOH B . E 4 HOH 6 64 6 HOH HOH B . E 4 HOH 7 65 40 HOH HOH B . E 4 HOH 8 66 42 HOH HOH B . E 4 HOH 9 67 43 HOH HOH B . E 4 HOH 10 68 44 HOH HOH B . E 4 HOH 11 69 62 HOH HOH B . E 4 HOH 12 70 94 HOH HOH B . E 4 HOH 13 71 98 HOH HOH B . E 4 HOH 14 72 99 HOH HOH B . E 4 HOH 15 73 100 HOH HOH B . E 4 HOH 16 74 101 HOH HOH B . E 4 HOH 17 75 116 HOH HOH B . E 4 HOH 18 76 117 HOH HOH B . E 4 HOH 19 77 122 HOH HOH B . E 4 HOH 20 78 127 HOH HOH B . E 4 HOH 21 79 129 HOH HOH B . E 4 HOH 22 80 131 HOH HOH B . E 4 HOH 23 81 132 HOH HOH B . E 4 HOH 24 82 138 HOH HOH B . E 4 HOH 25 83 146 HOH HOH B . E 4 HOH 26 84 149 HOH HOH B . E 4 HOH 27 85 152 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 77.2 ? 2 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 138.9 ? 3 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 84.3 ? 4 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 91.8 ? 5 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 164.3 ? 6 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 97.3 ? 7 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 275 ? 1_555 88.5 ? 8 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 275 ? 1_555 93.7 ? 9 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 275 ? 1_555 129.4 ? 10 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 275 ? 1_555 97.2 ? 11 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 322 ? 1_555 68.0 ? 12 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 322 ? 1_555 82.1 ? 13 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 322 ? 1_555 73.4 ? 14 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 322 ? 1_555 83.4 ? 15 O ? D HOH . ? A HOH 275 ? 1_555 CA ? C CA . ? A CA 246 ? 1_555 O ? D HOH . ? A HOH 322 ? 1_555 156.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-06-24 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-04-18 5 'Structure model' 1 4 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_detector 2 4 'Structure model' pdbx_database_status 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_initial_refinement_model 5 5 'Structure model' pdbx_struct_conn_angle 6 5 'Structure model' struct_conn 7 5 'Structure model' struct_ref_seq_dif 8 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_detector.detector' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.value' 18 5 'Structure model' '_struct_conn.pdbx_dist_value' 19 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 5 'Structure model' '_struct_ref_seq_dif.details' 32 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MADNES 'data collection' . ? 1 PROCOR 'data reduction' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 MADNES 'data reduction' . ? 5 PROCOR 'data scaling' . ? 6 X-PLOR phasing 3.1 ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 49 ? ? -55.99 -7.83 2 1 ASP A 71 ? ? -132.30 -65.17 3 1 SER A 150 ? ? -169.93 100.34 4 1 SER A 214 ? ? -129.64 -72.42 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B VAL 1 ? B VAL 1 2 1 Y 1 B ARG 2 ? B ARG 2 3 1 Y 1 B SER 57 ? B SER 57 4 1 Y 1 B ALA 58 ? B ALA 58 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2PTC _pdbx_initial_refinement_model.details 'PDB ENTRY 2PTC' #