data_1TBO # _entry.id 1TBO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TBO pdb_00001tbo 10.2210/pdb1tbo/pdb WWPDB D_1000176599 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TBO _pdbx_database_status.recvd_initial_deposition_date 1997-04-15 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1TBN _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, R.X.' 1 'Pawelczyk, T.' 2 'Xia, T.' 3 'Brown, S.C.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.' Biochemistry 36 10709 10717 1997 BICHAW US 0006-2960 0033 ? 9271501 10.1021/bi970833a 1 'Crystal Structure of the Cys2 Activator-Binding Domain of Protein Kinase C Delta in Complex with Phorbol Ester' 'Cell(Cambridge,Mass.)' 81 917 ? 1995 CELLB5 US 0092-8674 0998 ? ? ? 2 'Solution Structure of Cysteine-Rich Domain of Protein Kinase C Alpha' 'J.Biochem.(Tokyo)' 117 566 ? 1995 JOBIAO JA 0021-924X 0418 ? ? ? 3 'Solution Structure of a Cysteine Rich Domain of Rat Protein Kinase C' Nat.Struct.Biol. 1 383 ? 1994 NSBIEW US 1072-8368 2024 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, R.X.' 1 ? primary 'Pawelczyk, T.' 2 ? primary 'Xia, T.H.' 3 ? primary 'Brown, S.C.' 4 ? 1 'Zhang, G.' 5 ? 1 'Kazanietz, M.G.' 6 ? 1 'Blumberg, P.M.' 7 ? 1 'Hurley, J.H.' 8 ? 2 'Ichikawa, S.' 9 ? 2 'Hatanaka, H.' 10 ? 2 'Takeuchi, Y.' 11 ? 2 'Ohno, S.' 12 ? 2 'Inagaki, F.' 13 ? 3 'Hommel, U.' 14 ? 3 'Zurini, M.' 15 ? 3 'Luyten, M.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN KINASE C, GAMMA TYPE' 9359.666 1 2.7.1.- ? 'CYS2 DOMAIN' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RAT BRAIN PKC-G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTS DE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTS DE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLN n 1 4 THR n 1 5 ASP n 1 6 ASP n 1 7 PRO n 1 8 ARG n 1 9 ASN n 1 10 LYS n 1 11 HIS n 1 12 LYS n 1 13 PHE n 1 14 ARG n 1 15 LEU n 1 16 HIS n 1 17 SER n 1 18 TYR n 1 19 SER n 1 20 SER n 1 21 PRO n 1 22 THR n 1 23 PHE n 1 24 CYS n 1 25 ASP n 1 26 HIS n 1 27 CYS n 1 28 GLY n 1 29 SER n 1 30 LEU n 1 31 LEU n 1 32 TYR n 1 33 GLY n 1 34 LEU n 1 35 VAL n 1 36 HIS n 1 37 GLN n 1 38 GLY n 1 39 MET n 1 40 LYS n 1 41 CYS n 1 42 SER n 1 43 CYS n 1 44 CYS n 1 45 GLU n 1 46 MET n 1 47 ASN n 1 48 VAL n 1 49 HIS n 1 50 ARG n 1 51 ARG n 1 52 CYS n 1 53 VAL n 1 54 ARG n 1 55 SER n 1 56 VAL n 1 57 PRO n 1 58 SER n 1 59 LEU n 1 60 CYS n 1 61 GLY n 1 62 VAL n 1 63 ASP n 1 64 HIS n 1 65 THR n 1 66 GLU n 1 67 ARG n 1 68 ARG n 1 69 GLY n 1 70 ARG n 1 71 LEU n 1 72 GLN n 1 73 LEU n 1 74 GLU n 1 75 ILE n 1 76 ARG n 1 77 ALA n 1 78 PRO n 1 79 THR n 1 80 SER n 1 81 ASP n 1 82 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'black rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus rattus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10117 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ BRAIN _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 92 ? ? ? A . n A 1 2 PRO 2 93 ? ? ? A . n A 1 3 GLN 3 94 94 GLN GLN A . n A 1 4 THR 4 95 95 THR THR A . n A 1 5 ASP 5 96 96 ASP ASP A . n A 1 6 ASP 6 97 97 ASP ASP A . n A 1 7 PRO 7 98 98 PRO PRO A . n A 1 8 ARG 8 99 99 ARG ARG A . n A 1 9 ASN 9 100 100 ASN ASN A . n A 1 10 LYS 10 101 101 LYS LYS A . n A 1 11 HIS 11 102 102 HIS HIS A . n A 1 12 LYS 12 103 103 LYS LYS A . n A 1 13 PHE 13 104 104 PHE PHE A . n A 1 14 ARG 14 105 105 ARG ARG A . n A 1 15 LEU 15 106 106 LEU LEU A . n A 1 16 HIS 16 107 107 HIS HIS A . n A 1 17 SER 17 108 108 SER SER A . n A 1 18 TYR 18 109 109 TYR TYR A . n A 1 19 SER 19 110 110 SER SER A . n A 1 20 SER 20 111 111 SER SER A . n A 1 21 PRO 21 112 112 PRO PRO A . n A 1 22 THR 22 113 113 THR THR A . n A 1 23 PHE 23 114 114 PHE PHE A . n A 1 24 CYS 24 115 115 CYS CYS A . n A 1 25 ASP 25 116 116 ASP ASP A . n A 1 26 HIS 26 117 117 HIS HIS A . n A 1 27 CYS 27 118 118 CYS CYS A . n A 1 28 GLY 28 119 119 GLY GLY A . n A 1 29 SER 29 120 120 SER SER A . n A 1 30 LEU 30 121 121 LEU LEU A . n A 1 31 LEU 31 122 122 LEU LEU A . n A 1 32 TYR 32 123 123 TYR TYR A . n A 1 33 GLY 33 124 124 GLY GLY A . n A 1 34 LEU 34 125 125 LEU LEU A . n A 1 35 VAL 35 126 126 VAL VAL A . n A 1 36 HIS 36 127 127 HIS HIS A . n A 1 37 GLN 37 128 128 GLN GLN A . n A 1 38 GLY 38 129 129 GLY GLY A . n A 1 39 MET 39 130 130 MET MET A . n A 1 40 LYS 40 131 131 LYS LYS A . n A 1 41 CYS 41 132 132 CYS CYS A . n A 1 42 SER 42 133 133 SER SER A . n A 1 43 CYS 43 134 134 CYS CYS A . n A 1 44 CYS 44 135 135 CYS CYS A . n A 1 45 GLU 45 136 136 GLU GLU A . n A 1 46 MET 46 137 137 MET MET A . n A 1 47 ASN 47 138 138 ASN ASN A . n A 1 48 VAL 48 139 139 VAL VAL A . n A 1 49 HIS 49 140 140 HIS HIS A . n A 1 50 ARG 50 141 141 ARG ARG A . n A 1 51 ARG 51 142 142 ARG ARG A . n A 1 52 CYS 52 143 143 CYS CYS A . n A 1 53 VAL 53 144 144 VAL VAL A . n A 1 54 ARG 54 145 145 ARG ARG A . n A 1 55 SER 55 146 146 SER SER A . n A 1 56 VAL 56 147 147 VAL VAL A . n A 1 57 PRO 57 148 148 PRO PRO A . n A 1 58 SER 58 149 149 SER SER A . n A 1 59 LEU 59 150 150 LEU LEU A . n A 1 60 CYS 60 151 151 CYS CYS A . n A 1 61 GLY 61 152 152 GLY GLY A . n A 1 62 VAL 62 153 153 VAL VAL A . n A 1 63 ASP 63 154 154 ASP ASP A . n A 1 64 HIS 64 155 155 HIS HIS A . n A 1 65 THR 65 156 156 THR THR A . n A 1 66 GLU 66 157 157 GLU GLU A . n A 1 67 ARG 67 158 158 ARG ARG A . n A 1 68 ARG 68 159 159 ARG ARG A . n A 1 69 GLY 69 160 ? ? ? A . n A 1 70 ARG 70 161 ? ? ? A . n A 1 71 LEU 71 162 ? ? ? A . n A 1 72 GLN 72 163 ? ? ? A . n A 1 73 LEU 73 164 ? ? ? A . n A 1 74 GLU 74 165 ? ? ? A . n A 1 75 ILE 75 166 ? ? ? A . n A 1 76 ARG 76 167 ? ? ? A . n A 1 77 ALA 77 168 ? ? ? A . n A 1 78 PRO 78 169 ? ? ? A . n A 1 79 THR 79 170 ? ? ? A . n A 1 80 SER 80 171 ? ? ? A . n A 1 81 ASP 81 172 ? ? ? A . n A 1 82 GLU 82 173 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1 1 ZN ZN A . C 2 ZN 1 2 2 ZN ZN A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1TBO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TBO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1TBO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1TBO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TBO _struct.title 'NMR STRUCTURE OF A PROTEIN KINASE C-G PHORBOL-BINDING DOMAIN, 30 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TBO _struct_keywords.pdbx_keywords 'CALCIUM-BINDING PROTEIN' _struct_keywords.text 'CALCIUM-BINDING PROTEIN, PROTEIN KINASE C, PKC, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KPCG_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P05697 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEF VTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGR LQLEIRAPTSDEIHITVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFVFNLKPGDVERRL SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPS SSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEK RVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDE EELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSG ENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TBO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05697 _struct_ref_seq.db_align_beg 91 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 172 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 92 _struct_ref_seq.pdbx_auth_seq_align_end 173 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 11 ND1 ? ? A ZN 1 A HIS 102 1_555 ? ? ? ? ? ? ? 1.775 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 41 SG ? ? A ZN 1 A CYS 132 1_555 ? ? ? ? ? ? ? 2.467 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 44 SG ? ? A ZN 1 A CYS 135 1_555 ? ? ? ? ? ? ? 2.109 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 60 SG ? ? A ZN 1 A CYS 151 1_555 ? ? ? ? ? ? ? 2.739 ? ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 24 SG ? ? A ZN 2 A CYS 115 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 27 SG ? ? A ZN 2 A CYS 118 1_555 ? ? ? ? ? ? ? 2.407 ? ? metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 49 ND1 ? ? A ZN 2 A HIS 140 1_555 ? ? ? ? ? ? ? 1.957 ? ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 52 SG ? ? A ZN 2 A CYS 143 1_555 ? ? ? ? ? ? ? 2.415 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 11 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 41 ? A CYS 132 ? 1_555 123.1 ? 2 ND1 ? A HIS 11 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 44 ? A CYS 135 ? 1_555 127.8 ? 3 SG ? A CYS 41 ? A CYS 132 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 44 ? A CYS 135 ? 1_555 106.0 ? 4 ND1 ? A HIS 11 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 60 ? A CYS 151 ? 1_555 90.3 ? 5 SG ? A CYS 41 ? A CYS 132 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 60 ? A CYS 151 ? 1_555 89.0 ? 6 SG ? A CYS 44 ? A CYS 135 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 60 ? A CYS 151 ? 1_555 108.6 ? 7 SG ? A CYS 24 ? A CYS 115 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 27 ? A CYS 118 ? 1_555 90.4 ? 8 SG ? A CYS 24 ? A CYS 115 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 ND1 ? A HIS 49 ? A HIS 140 ? 1_555 97.5 ? 9 SG ? A CYS 27 ? A CYS 118 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 ND1 ? A HIS 49 ? A HIS 140 ? 1_555 87.4 ? 10 SG ? A CYS 24 ? A CYS 115 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 52 ? A CYS 143 ? 1_555 138.9 ? 11 SG ? A CYS 27 ? A CYS 118 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 52 ? A CYS 143 ? 1_555 118.7 ? 12 ND1 ? A HIS 49 ? A HIS 140 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 52 ? A CYS 143 ? 1_555 111.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 13 ? LEU A 15 ? PHE A 104 LEU A 106 A 2 MET A 39 ? CYS A 41 ? MET A 130 CYS A 132 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 14 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 105 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 40 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 131 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 1 ? 4 'BINDING SITE FOR RESIDUE ZN A 1' AC2 Software A ZN 2 ? 4 'BINDING SITE FOR RESIDUE ZN A 2' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 11 ? HIS A 102 . ? 1_555 ? 2 AC1 4 CYS A 41 ? CYS A 132 . ? 1_555 ? 3 AC1 4 CYS A 44 ? CYS A 135 . ? 1_555 ? 4 AC1 4 CYS A 60 ? CYS A 151 . ? 1_555 ? 5 AC2 4 CYS A 24 ? CYS A 115 . ? 1_555 ? 6 AC2 4 CYS A 27 ? CYS A 118 . ? 1_555 ? 7 AC2 4 HIS A 49 ? HIS A 140 . ? 1_555 ? 8 AC2 4 CYS A 52 ? CYS A 143 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 95 ? ? -156.37 -41.11 2 1 ASN A 100 ? ? -128.67 -136.16 3 1 HIS A 102 ? ? -44.81 154.16 4 1 LYS A 103 ? ? -94.15 47.95 5 1 SER A 110 ? ? 161.81 -59.84 6 1 LEU A 121 ? ? -43.54 151.92 7 1 LEU A 125 ? ? -138.39 -38.34 8 1 GLN A 128 ? ? -138.26 -72.51 9 1 SER A 133 ? ? -83.85 44.25 10 1 CYS A 134 ? ? -150.11 -40.56 11 1 GLU A 136 ? ? 76.13 81.76 12 1 SER A 149 ? ? 61.34 89.95 13 1 ASP A 154 ? ? -114.88 -169.95 14 2 PRO A 98 ? ? -77.35 -159.13 15 2 ARG A 99 ? ? -81.09 -140.63 16 2 LYS A 103 ? ? -90.56 46.34 17 2 PHE A 104 ? ? -39.80 148.55 18 2 LEU A 122 ? ? -68.72 90.21 19 2 TYR A 123 ? ? -53.17 -172.57 20 2 GLN A 128 ? ? 77.99 -75.46 21 2 SER A 133 ? ? -84.40 38.52 22 2 CYS A 134 ? ? -150.49 -38.45 23 2 GLU A 136 ? ? 62.48 74.96 24 2 SER A 149 ? ? 64.68 93.94 25 3 LYS A 103 ? ? -89.96 43.02 26 3 SER A 110 ? ? 160.83 -25.67 27 3 LEU A 122 ? ? -86.57 35.93 28 3 HIS A 127 ? ? -50.10 107.59 29 3 GLN A 128 ? ? 63.77 -87.52 30 3 SER A 133 ? ? -84.51 45.11 31 3 CYS A 134 ? ? -146.84 -39.26 32 3 GLU A 136 ? ? 70.66 73.03 33 3 SER A 149 ? ? 75.96 75.65 34 3 HIS A 155 ? ? -165.15 50.00 35 3 THR A 156 ? ? 47.18 95.03 36 4 THR A 95 ? ? -98.99 43.86 37 4 ARG A 99 ? ? -142.24 31.87 38 4 LYS A 103 ? ? -89.67 49.07 39 4 PHE A 104 ? ? -39.57 137.46 40 4 TYR A 123 ? ? -48.81 177.08 41 4 HIS A 127 ? ? -50.07 92.45 42 4 GLN A 128 ? ? 62.39 -91.37 43 4 SER A 133 ? ? -84.53 45.70 44 4 CYS A 134 ? ? -148.83 -39.06 45 4 GLU A 136 ? ? 62.04 76.49 46 4 PRO A 148 ? ? -80.54 40.38 47 4 CYS A 151 ? ? -103.83 62.39 48 5 ASP A 96 ? ? -58.61 -175.40 49 5 ASP A 97 ? ? -158.63 66.44 50 5 ARG A 99 ? ? -177.47 134.35 51 5 ASN A 100 ? ? -96.44 31.02 52 5 SER A 111 ? ? 179.80 156.53 53 5 ASP A 116 ? ? -87.77 35.41 54 5 HIS A 117 ? ? -140.20 -40.05 55 5 LEU A 122 ? ? -56.22 93.90 56 5 LEU A 125 ? ? -156.27 -84.31 57 5 HIS A 127 ? ? -44.56 104.62 58 5 GLN A 128 ? ? 69.23 -142.52 59 5 SER A 133 ? ? -84.18 45.44 60 5 CYS A 134 ? ? -148.12 -39.09 61 5 GLU A 136 ? ? 66.35 66.85 62 5 LEU A 150 ? ? -90.34 39.50 63 5 THR A 156 ? ? -64.96 -178.72 64 6 ASP A 96 ? ? -114.14 75.31 65 6 ASP A 97 ? ? -155.00 75.82 66 6 ARG A 99 ? ? -169.40 36.51 67 6 ASN A 100 ? ? -93.60 35.42 68 6 LYS A 103 ? ? -91.25 40.69 69 6 SER A 110 ? ? 161.88 -25.91 70 6 ASP A 116 ? ? -88.86 35.75 71 6 HIS A 117 ? ? -138.75 -39.16 72 6 LEU A 122 ? ? -52.61 88.89 73 6 TYR A 123 ? ? -46.03 163.19 74 6 HIS A 127 ? ? 42.94 -94.54 75 6 CYS A 135 ? ? -150.11 11.17 76 6 PRO A 148 ? ? -80.45 40.98 77 6 SER A 149 ? ? 49.41 22.28 78 6 VAL A 153 ? ? -160.13 -155.39 79 6 HIS A 155 ? ? 177.55 -65.94 80 6 ARG A 158 ? ? -148.14 -67.10 81 7 TYR A 123 ? ? -55.15 -165.08 82 7 GLN A 128 ? ? -167.39 -51.14 83 7 GLU A 136 ? ? 60.29 74.90 84 7 SER A 149 ? ? 70.98 53.21 85 7 LEU A 150 ? ? -91.00 47.63 86 7 THR A 156 ? ? -91.12 36.94 87 8 ASN A 100 ? ? -155.37 32.45 88 8 LYS A 103 ? ? -89.43 45.91 89 8 PHE A 104 ? ? -39.81 135.10 90 8 GLN A 128 ? ? -155.66 -45.41 91 8 CYS A 134 ? ? -130.91 -30.84 92 8 GLU A 136 ? ? 64.26 79.43 93 8 PRO A 148 ? ? -80.73 41.70 94 8 LEU A 150 ? ? -94.56 44.35 95 9 ASP A 97 ? ? 179.92 102.55 96 9 ARG A 99 ? ? -144.80 35.32 97 9 LYS A 103 ? ? -89.77 45.71 98 9 TYR A 109 ? ? -145.58 34.79 99 9 SER A 110 ? ? 76.77 -0.51 100 9 SER A 111 ? ? -179.85 149.65 101 9 TYR A 123 ? ? -58.27 -154.93 102 9 GLN A 128 ? ? 83.49 -57.19 103 9 SER A 133 ? ? -83.99 43.39 104 9 CYS A 134 ? ? -144.12 -39.26 105 9 GLU A 136 ? ? 62.85 74.88 106 9 SER A 149 ? ? 73.43 40.88 107 9 LEU A 150 ? ? -88.90 47.45 108 9 ARG A 158 ? ? -101.87 71.31 109 10 ASN A 100 ? ? -92.56 37.22 110 10 HIS A 102 ? ? -45.90 165.64 111 10 TYR A 109 ? ? -161.66 -77.30 112 10 SER A 110 ? ? 173.97 -32.74 113 10 TYR A 123 ? ? -46.86 173.42 114 10 LEU A 125 ? ? -153.84 -38.22 115 10 HIS A 127 ? ? -43.96 96.83 116 10 GLN A 128 ? ? 67.72 -100.60 117 10 SER A 133 ? ? -84.32 45.16 118 10 CYS A 134 ? ? -149.38 -37.68 119 10 GLU A 136 ? ? 71.69 80.58 120 10 SER A 149 ? ? 162.54 66.12 121 10 LEU A 150 ? ? -88.22 36.90 122 10 ASP A 154 ? ? -110.90 64.42 123 11 ASP A 96 ? ? -178.22 67.51 124 11 LYS A 103 ? ? -91.70 43.62 125 11 PHE A 104 ? ? -39.47 136.87 126 11 TYR A 109 ? ? -87.05 -150.12 127 11 HIS A 117 ? ? -134.98 -37.63 128 11 LEU A 122 ? ? -53.59 88.97 129 11 TYR A 123 ? ? -54.35 176.36 130 11 GLN A 128 ? ? -136.35 -147.79 131 11 PRO A 148 ? ? -80.39 41.72 132 11 SER A 149 ? ? 46.98 24.42 133 11 VAL A 153 ? ? -110.15 62.29 134 11 ASP A 154 ? ? -70.26 -159.12 135 11 HIS A 155 ? ? -115.19 65.12 136 11 GLU A 157 ? ? -69.56 -156.83 137 12 ASP A 96 ? ? -90.88 42.05 138 12 PRO A 98 ? ? -78.16 -159.12 139 12 LYS A 103 ? ? -89.53 46.74 140 12 SER A 110 ? ? 168.17 -29.40 141 12 TYR A 123 ? ? -43.40 162.23 142 12 HIS A 127 ? ? 43.76 -147.34 143 12 SER A 133 ? ? -84.10 44.30 144 12 CYS A 134 ? ? -149.99 -39.17 145 12 GLU A 136 ? ? 63.31 75.25 146 12 SER A 149 ? ? 75.98 59.74 147 12 LEU A 150 ? ? -85.72 44.78 148 12 HIS A 155 ? ? -169.39 -34.81 149 13 ASP A 96 ? ? -112.58 60.36 150 13 ASN A 100 ? ? -113.04 53.74 151 13 LYS A 103 ? ? -93.67 43.27 152 13 PHE A 104 ? ? -39.83 144.33 153 13 SER A 110 ? ? 169.84 -30.86 154 13 ASP A 116 ? ? -89.53 36.17 155 13 HIS A 117 ? ? -140.50 -39.23 156 13 TYR A 123 ? ? -52.93 -171.30 157 13 LEU A 125 ? ? -156.63 -38.98 158 13 GLN A 128 ? ? 179.68 -36.19 159 13 SER A 133 ? ? -85.27 40.94 160 13 CYS A 134 ? ? -150.31 -38.44 161 13 GLU A 136 ? ? 71.27 80.85 162 13 PRO A 148 ? ? -80.48 42.56 163 13 SER A 149 ? ? 63.82 63.76 164 13 ASP A 154 ? ? -59.34 108.07 165 13 THR A 156 ? ? 44.54 91.03 166 14 ASP A 96 ? ? 177.61 73.93 167 14 ARG A 99 ? ? -111.28 -144.37 168 14 LYS A 103 ? ? -89.52 47.45 169 14 PHE A 104 ? ? -39.68 141.40 170 14 LEU A 125 ? ? -146.31 -47.89 171 14 HIS A 127 ? ? -52.58 89.83 172 14 GLN A 128 ? ? 62.67 -145.66 173 14 SER A 133 ? ? -84.39 44.99 174 14 CYS A 134 ? ? -150.14 -39.38 175 14 GLU A 136 ? ? 69.33 79.89 176 14 HIS A 140 ? ? -74.60 -168.68 177 14 SER A 149 ? ? 51.09 78.21 178 14 LEU A 150 ? ? -103.33 41.52 179 14 ASP A 154 ? ? -130.62 -45.80 180 14 HIS A 155 ? ? -155.29 56.18 181 14 ARG A 158 ? ? -107.09 64.62 182 15 THR A 95 ? ? -147.74 25.25 183 15 ASP A 96 ? ? 61.57 139.25 184 15 ASP A 97 ? ? -173.54 97.40 185 15 LYS A 103 ? ? -89.49 43.57 186 15 SER A 110 ? ? 174.13 -32.63 187 15 LEU A 122 ? ? -67.27 87.82 188 15 TYR A 123 ? ? -50.65 -177.79 189 15 HIS A 127 ? ? -47.91 96.01 190 15 GLN A 128 ? ? 66.37 -85.47 191 15 CYS A 134 ? ? -136.13 -30.99 192 15 GLU A 136 ? ? 63.84 77.57 193 15 SER A 149 ? ? 75.03 72.62 194 15 ASP A 154 ? ? -62.85 -152.04 195 15 ARG A 158 ? ? -116.54 69.86 196 16 THR A 95 ? ? -145.60 -57.89 197 16 ASP A 96 ? ? 44.99 84.74 198 16 ASN A 100 ? ? -121.90 -135.60 199 16 HIS A 102 ? ? -41.75 151.10 200 16 LYS A 103 ? ? -89.72 49.59 201 16 PHE A 104 ? ? -39.90 139.86 202 16 SER A 110 ? ? 83.43 -43.40 203 16 TYR A 123 ? ? -56.72 -159.95 204 16 HIS A 127 ? ? -49.98 91.02 205 16 GLN A 128 ? ? 67.95 -83.44 206 16 SER A 133 ? ? -84.58 45.00 207 16 CYS A 134 ? ? -149.04 -39.35 208 16 GLU A 136 ? ? 69.14 78.84 209 16 HIS A 140 ? ? -75.34 -169.06 210 16 PRO A 148 ? ? -80.73 41.63 211 16 SER A 149 ? ? 44.37 73.98 212 16 LEU A 150 ? ? -94.84 45.26 213 16 ASP A 154 ? ? -76.39 -161.71 214 16 THR A 156 ? ? 48.12 88.79 215 17 ASP A 97 ? ? -45.17 104.63 216 17 LYS A 103 ? ? -89.38 47.79 217 17 TYR A 109 ? ? -111.27 -169.00 218 17 SER A 111 ? ? 179.84 164.07 219 17 LEU A 122 ? ? -61.14 88.57 220 17 TYR A 123 ? ? -62.96 -171.43 221 17 LEU A 125 ? ? -148.25 -37.83 222 17 GLN A 128 ? ? -142.77 -146.47 223 17 CYS A 134 ? ? -133.76 -34.96 224 17 GLU A 136 ? ? 70.32 81.25 225 17 THR A 156 ? ? -89.19 -154.81 226 18 ASP A 97 ? ? -47.49 106.30 227 18 PRO A 98 ? ? -77.40 -159.08 228 18 ASN A 100 ? ? -101.74 76.52 229 18 LYS A 103 ? ? -90.50 42.24 230 18 PHE A 104 ? ? -39.77 142.54 231 18 SER A 110 ? ? 76.48 -1.32 232 18 PHE A 114 ? ? -79.16 -168.09 233 18 TYR A 123 ? ? -39.69 143.52 234 18 HIS A 127 ? ? 42.10 74.02 235 18 GLN A 128 ? ? 63.18 -143.93 236 18 SER A 133 ? ? -82.80 38.11 237 18 CYS A 134 ? ? -150.76 -37.92 238 18 PRO A 148 ? ? -80.38 39.32 239 18 SER A 149 ? ? 43.95 26.93 240 18 ASP A 154 ? ? -58.24 171.78 241 18 GLU A 157 ? ? -59.09 -169.83 242 18 ARG A 158 ? ? -119.75 70.48 243 19 ARG A 99 ? ? -150.21 18.55 244 19 ASN A 100 ? ? -166.87 61.65 245 19 LYS A 103 ? ? -94.12 45.09 246 19 LEU A 122 ? ? -63.44 87.90 247 19 TYR A 123 ? ? -50.92 -178.45 248 19 LEU A 125 ? ? -139.51 -39.10 249 19 GLN A 128 ? ? -168.03 -67.68 250 19 CYS A 134 ? ? -135.07 -32.75 251 19 GLU A 136 ? ? 62.18 77.53 252 19 HIS A 155 ? ? -157.92 76.26 253 19 THR A 156 ? ? -126.38 -82.16 254 19 GLU A 157 ? ? -129.83 -164.42 255 19 ARG A 158 ? ? -93.02 42.75 256 20 ASP A 96 ? ? 42.04 -166.87 257 20 ASP A 97 ? ? -179.54 95.96 258 20 ARG A 99 ? ? -148.16 19.69 259 20 HIS A 102 ? ? -43.36 167.89 260 20 HIS A 127 ? ? 50.40 -179.78 261 20 GLN A 128 ? ? -49.34 -93.23 262 20 GLU A 136 ? ? 58.62 73.83 263 20 SER A 149 ? ? 164.00 45.32 264 20 ASP A 154 ? ? -158.89 33.76 265 20 HIS A 155 ? ? 52.28 -89.87 266 20 ARG A 158 ? ? -86.61 -77.26 267 21 ASN A 100 ? ? -173.12 42.89 268 21 LYS A 103 ? ? -89.59 46.09 269 21 PHE A 104 ? ? -39.50 135.03 270 21 ASP A 116 ? ? -89.19 35.69 271 21 HIS A 117 ? ? -138.22 -39.77 272 21 TYR A 123 ? ? -42.47 158.18 273 21 HIS A 127 ? ? -42.95 95.18 274 21 GLN A 128 ? ? 37.37 -133.71 275 21 SER A 133 ? ? -84.63 45.48 276 21 CYS A 134 ? ? -147.96 -38.79 277 21 GLU A 136 ? ? 72.37 80.12 278 21 SER A 149 ? ? 70.81 39.04 279 21 ASP A 154 ? ? -103.52 -153.01 280 21 THR A 156 ? ? 46.66 25.39 281 21 ARG A 158 ? ? -92.81 43.88 282 22 ASP A 96 ? ? -60.78 96.66 283 22 ASP A 97 ? ? -169.30 71.56 284 22 ARG A 99 ? ? -162.31 111.75 285 22 LYS A 103 ? ? -89.52 43.68 286 22 LEU A 122 ? ? -53.58 89.28 287 22 TYR A 123 ? ? -52.62 -176.80 288 22 GLN A 128 ? ? -173.27 -47.74 289 22 SER A 133 ? ? -84.86 34.34 290 22 CYS A 134 ? ? -133.14 -34.74 291 22 GLU A 136 ? ? 62.97 76.13 292 22 SER A 149 ? ? 73.85 87.00 293 22 ASP A 154 ? ? -175.62 141.00 294 23 THR A 95 ? ? -102.28 -91.26 295 23 ASP A 96 ? ? 48.82 -171.93 296 23 ARG A 99 ? ? -106.02 -143.26 297 23 ASN A 100 ? ? -113.73 69.90 298 23 LYS A 103 ? ? -94.14 46.35 299 23 PHE A 104 ? ? -39.51 134.28 300 23 LEU A 122 ? ? -66.63 -159.26 301 23 HIS A 127 ? ? 43.41 76.83 302 23 GLN A 128 ? ? 64.34 -91.68 303 23 SER A 133 ? ? -85.20 47.94 304 23 CYS A 134 ? ? -150.01 -38.14 305 23 GLU A 136 ? ? 77.90 80.11 306 23 PRO A 148 ? ? -80.97 31.39 307 23 SER A 149 ? ? 44.30 83.42 308 23 ASP A 154 ? ? -45.56 -92.95 309 23 HIS A 155 ? ? 162.90 -80.41 310 23 GLU A 157 ? ? -145.34 52.56 311 24 ASP A 96 ? ? -116.47 68.33 312 24 ARG A 99 ? ? -179.31 135.86 313 24 ASN A 100 ? ? -115.29 74.78 314 24 LYS A 103 ? ? -90.33 51.67 315 24 PHE A 104 ? ? -39.25 131.47 316 24 SER A 110 ? ? 173.80 -31.28 317 24 ASP A 116 ? ? -88.61 33.46 318 24 HIS A 117 ? ? -141.54 -35.35 319 24 LEU A 122 ? ? -58.89 88.84 320 24 TYR A 123 ? ? -60.31 -168.31 321 24 LEU A 125 ? ? -147.10 -38.27 322 24 GLN A 128 ? ? -169.16 -164.46 323 24 SER A 133 ? ? -84.50 44.57 324 24 CYS A 134 ? ? -149.07 -38.53 325 24 GLU A 136 ? ? 68.14 78.37 326 24 SER A 149 ? ? 71.57 69.52 327 24 LEU A 150 ? ? -106.60 45.94 328 24 ASP A 154 ? ? -127.90 -164.97 329 24 HIS A 155 ? ? -89.40 -70.34 330 24 THR A 156 ? ? 82.28 -42.75 331 25 HIS A 102 ? ? -56.82 172.68 332 25 LYS A 103 ? ? -150.31 39.04 333 25 TYR A 109 ? ? -59.92 -162.95 334 25 TYR A 123 ? ? -59.34 -152.07 335 25 HIS A 127 ? ? -51.19 93.86 336 25 GLN A 128 ? ? 75.70 -79.93 337 25 GLU A 136 ? ? 55.99 71.17 338 25 SER A 149 ? ? -42.53 95.38 339 25 LEU A 150 ? ? -155.61 75.33 340 25 ASP A 154 ? ? -177.87 -48.24 341 25 HIS A 155 ? ? 61.43 -90.50 342 25 THR A 156 ? ? 46.44 82.92 343 25 ARG A 158 ? ? -134.59 -66.76 344 26 THR A 95 ? ? -79.50 -155.28 345 26 ARG A 99 ? ? -136.35 -145.99 346 26 ASN A 100 ? ? -104.93 68.79 347 26 HIS A 102 ? ? -51.81 174.44 348 26 LYS A 103 ? ? -150.49 36.28 349 26 SER A 108 ? ? -150.23 87.97 350 26 SER A 110 ? ? 162.35 -26.71 351 26 TYR A 123 ? ? -43.45 153.52 352 26 LEU A 125 ? ? -151.63 -37.53 353 26 HIS A 127 ? ? 44.07 90.32 354 26 GLN A 128 ? ? 72.40 -80.49 355 26 GLU A 136 ? ? 57.64 72.80 356 26 PRO A 148 ? ? -80.59 41.01 357 26 SER A 149 ? ? 45.38 77.53 358 26 VAL A 153 ? ? -160.71 -155.28 359 26 HIS A 155 ? ? 62.43 -95.20 360 26 THR A 156 ? ? 42.85 -165.29 361 27 THR A 95 ? ? -147.63 30.58 362 27 ARG A 99 ? ? -140.95 56.41 363 27 ASN A 100 ? ? -160.87 37.43 364 27 LYS A 103 ? ? -142.78 40.65 365 27 SER A 108 ? ? -150.12 70.01 366 27 SER A 110 ? ? 163.82 -27.52 367 27 TYR A 123 ? ? -44.20 169.24 368 27 HIS A 127 ? ? 44.12 90.69 369 27 GLN A 128 ? ? 63.40 -96.81 370 27 SER A 133 ? ? -84.58 41.24 371 27 CYS A 134 ? ? -150.58 -36.88 372 27 GLU A 136 ? ? 69.69 79.43 373 27 PRO A 148 ? ? -80.54 33.11 374 27 SER A 149 ? ? 43.13 90.72 375 27 VAL A 153 ? ? -160.12 89.26 376 27 HIS A 155 ? ? 178.20 139.15 377 27 GLU A 157 ? ? -98.92 -156.53 378 28 ASP A 96 ? ? -177.58 71.40 379 28 PRO A 98 ? ? -77.97 -160.05 380 28 ARG A 99 ? ? -106.93 -144.84 381 28 ASN A 100 ? ? -135.27 -137.02 382 28 HIS A 102 ? ? -44.06 162.62 383 28 LYS A 103 ? ? -89.21 45.26 384 28 PHE A 104 ? ? -39.64 137.16 385 28 TYR A 109 ? ? -82.09 -157.08 386 28 TYR A 123 ? ? -40.83 150.98 387 28 HIS A 127 ? ? 40.84 78.94 388 28 GLN A 128 ? ? 60.00 -159.65 389 28 SER A 133 ? ? -84.45 41.60 390 28 CYS A 134 ? ? -150.19 -39.50 391 28 ASP A 154 ? ? -178.74 -39.33 392 28 HIS A 155 ? ? 39.89 90.78 393 28 THR A 156 ? ? -56.88 -170.56 394 29 ASP A 96 ? ? 42.30 -155.48 395 29 ASP A 97 ? ? -179.31 98.02 396 29 ASN A 100 ? ? -98.76 45.02 397 29 LYS A 103 ? ? -90.01 46.54 398 29 SER A 110 ? ? 162.04 -24.99 399 29 LEU A 122 ? ? -84.25 43.62 400 29 HIS A 127 ? ? -43.61 -72.22 401 29 SER A 133 ? ? -84.07 44.35 402 29 CYS A 134 ? ? -148.06 -38.50 403 29 GLU A 136 ? ? 62.27 75.09 404 29 PRO A 148 ? ? -80.72 41.85 405 29 LEU A 150 ? ? -88.91 34.34 406 29 HIS A 155 ? ? -137.28 -56.83 407 29 THR A 156 ? ? 63.08 148.53 408 30 ASP A 96 ? ? 171.34 99.20 409 30 ASP A 97 ? ? -175.92 149.58 410 30 PRO A 98 ? ? -77.74 -157.20 411 30 ARG A 99 ? ? -61.25 -130.53 412 30 ASN A 100 ? ? -107.83 -139.13 413 30 LYS A 103 ? ? -89.83 41.51 414 30 PHE A 104 ? ? -39.83 134.34 415 30 SER A 110 ? ? 160.15 -24.74 416 30 LEU A 122 ? ? -67.30 86.29 417 30 TYR A 123 ? ? -43.34 161.62 418 30 LEU A 125 ? ? -150.70 -37.64 419 30 HIS A 127 ? ? 80.05 -72.75 420 30 GLN A 128 ? ? -136.34 -65.45 421 30 SER A 133 ? ? -85.74 41.50 422 30 CYS A 134 ? ? -150.89 -37.75 423 30 GLU A 136 ? ? 64.47 80.08 424 30 SER A 149 ? ? 74.05 53.68 425 30 LEU A 150 ? ? -85.05 46.61 426 30 ASP A 154 ? ? -175.14 53.90 427 30 GLU A 157 ? ? -116.72 -157.91 428 30 ARG A 158 ? ? -86.69 46.82 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 99 ? ? 0.178 'SIDE CHAIN' 2 1 ARG A 105 ? ? 0.096 'SIDE CHAIN' 3 1 ARG A 141 ? ? 0.315 'SIDE CHAIN' 4 1 ARG A 142 ? ? 0.296 'SIDE CHAIN' 5 1 ARG A 145 ? ? 0.267 'SIDE CHAIN' 6 1 ARG A 158 ? ? 0.316 'SIDE CHAIN' 7 1 ARG A 159 ? ? 0.310 'SIDE CHAIN' 8 2 ARG A 99 ? ? 0.308 'SIDE CHAIN' 9 2 ARG A 105 ? ? 0.316 'SIDE CHAIN' 10 2 ARG A 141 ? ? 0.262 'SIDE CHAIN' 11 2 ARG A 142 ? ? 0.152 'SIDE CHAIN' 12 2 ARG A 145 ? ? 0.317 'SIDE CHAIN' 13 2 ARG A 158 ? ? 0.308 'SIDE CHAIN' 14 2 ARG A 159 ? ? 0.274 'SIDE CHAIN' 15 3 ARG A 99 ? ? 0.249 'SIDE CHAIN' 16 3 ARG A 105 ? ? 0.224 'SIDE CHAIN' 17 3 ARG A 141 ? ? 0.091 'SIDE CHAIN' 18 3 ARG A 142 ? ? 0.317 'SIDE CHAIN' 19 3 ARG A 145 ? ? 0.304 'SIDE CHAIN' 20 3 ARG A 158 ? ? 0.256 'SIDE CHAIN' 21 3 ARG A 159 ? ? 0.298 'SIDE CHAIN' 22 4 ARG A 99 ? ? 0.205 'SIDE CHAIN' 23 4 ARG A 105 ? ? 0.310 'SIDE CHAIN' 24 4 ARG A 141 ? ? 0.239 'SIDE CHAIN' 25 4 ARG A 142 ? ? 0.301 'SIDE CHAIN' 26 4 ARG A 145 ? ? 0.217 'SIDE CHAIN' 27 4 ARG A 158 ? ? 0.119 'SIDE CHAIN' 28 4 ARG A 159 ? ? 0.230 'SIDE CHAIN' 29 5 ARG A 99 ? ? 0.088 'SIDE CHAIN' 30 5 ARG A 105 ? ? 0.248 'SIDE CHAIN' 31 5 ARG A 141 ? ? 0.088 'SIDE CHAIN' 32 5 ARG A 142 ? ? 0.169 'SIDE CHAIN' 33 5 ARG A 145 ? ? 0.282 'SIDE CHAIN' 34 5 ARG A 158 ? ? 0.308 'SIDE CHAIN' 35 5 ARG A 159 ? ? 0.235 'SIDE CHAIN' 36 6 ARG A 99 ? ? 0.203 'SIDE CHAIN' 37 6 ARG A 105 ? ? 0.116 'SIDE CHAIN' 38 6 ARG A 141 ? ? 0.313 'SIDE CHAIN' 39 6 ARG A 142 ? ? 0.304 'SIDE CHAIN' 40 6 ARG A 145 ? ? 0.269 'SIDE CHAIN' 41 6 ARG A 158 ? ? 0.221 'SIDE CHAIN' 42 6 ARG A 159 ? ? 0.275 'SIDE CHAIN' 43 7 ARG A 99 ? ? 0.267 'SIDE CHAIN' 44 7 ARG A 105 ? ? 0.279 'SIDE CHAIN' 45 7 ARG A 141 ? ? 0.307 'SIDE CHAIN' 46 7 ARG A 142 ? ? 0.219 'SIDE CHAIN' 47 7 ARG A 145 ? ? 0.297 'SIDE CHAIN' 48 7 ARG A 158 ? ? 0.196 'SIDE CHAIN' 49 7 ARG A 159 ? ? 0.317 'SIDE CHAIN' 50 8 ARG A 99 ? ? 0.304 'SIDE CHAIN' 51 8 ARG A 105 ? ? 0.242 'SIDE CHAIN' 52 8 ARG A 141 ? ? 0.253 'SIDE CHAIN' 53 8 ARG A 142 ? ? 0.317 'SIDE CHAIN' 54 8 ARG A 145 ? ? 0.281 'SIDE CHAIN' 55 8 ARG A 158 ? ? 0.229 'SIDE CHAIN' 56 8 ARG A 159 ? ? 0.315 'SIDE CHAIN' 57 9 ARG A 99 ? ? 0.298 'SIDE CHAIN' 58 9 ARG A 105 ? ? 0.193 'SIDE CHAIN' 59 9 ARG A 141 ? ? 0.314 'SIDE CHAIN' 60 9 ARG A 142 ? ? 0.280 'SIDE CHAIN' 61 9 ARG A 145 ? ? 0.231 'SIDE CHAIN' 62 9 ARG A 158 ? ? 0.198 'SIDE CHAIN' 63 9 ARG A 159 ? ? 0.243 'SIDE CHAIN' 64 10 ARG A 99 ? ? 0.206 'SIDE CHAIN' 65 10 ARG A 105 ? ? 0.198 'SIDE CHAIN' 66 10 ARG A 141 ? ? 0.092 'SIDE CHAIN' 67 10 ARG A 142 ? ? 0.163 'SIDE CHAIN' 68 10 ARG A 145 ? ? 0.318 'SIDE CHAIN' 69 10 ARG A 158 ? ? 0.302 'SIDE CHAIN' 70 10 ARG A 159 ? ? 0.316 'SIDE CHAIN' 71 11 ARG A 99 ? ? 0.170 'SIDE CHAIN' 72 11 ARG A 105 ? ? 0.269 'SIDE CHAIN' 73 11 ARG A 141 ? ? 0.304 'SIDE CHAIN' 74 11 ARG A 142 ? ? 0.264 'SIDE CHAIN' 75 11 ARG A 145 ? ? 0.271 'SIDE CHAIN' 76 11 ARG A 158 ? ? 0.299 'SIDE CHAIN' 77 11 ARG A 159 ? ? 0.255 'SIDE CHAIN' 78 12 ARG A 99 ? ? 0.198 'SIDE CHAIN' 79 12 ARG A 105 ? ? 0.155 'SIDE CHAIN' 80 12 ARG A 141 ? ? 0.282 'SIDE CHAIN' 81 12 ARG A 142 ? ? 0.211 'SIDE CHAIN' 82 12 ARG A 145 ? ? 0.206 'SIDE CHAIN' 83 12 ARG A 158 ? ? 0.305 'SIDE CHAIN' 84 12 ARG A 159 ? ? 0.314 'SIDE CHAIN' 85 13 ARG A 99 ? ? 0.316 'SIDE CHAIN' 86 13 ARG A 105 ? ? 0.287 'SIDE CHAIN' 87 13 ARG A 141 ? ? 0.193 'SIDE CHAIN' 88 13 ARG A 142 ? ? 0.197 'SIDE CHAIN' 89 13 ARG A 145 ? ? 0.312 'SIDE CHAIN' 90 13 ARG A 158 ? ? 0.318 'SIDE CHAIN' 91 13 ARG A 159 ? ? 0.285 'SIDE CHAIN' 92 14 ARG A 99 ? ? 0.243 'SIDE CHAIN' 93 14 ARG A 105 ? ? 0.268 'SIDE CHAIN' 94 14 ARG A 142 ? ? 0.318 'SIDE CHAIN' 95 14 ARG A 145 ? ? 0.208 'SIDE CHAIN' 96 14 ARG A 158 ? ? 0.301 'SIDE CHAIN' 97 14 ARG A 159 ? ? 0.115 'SIDE CHAIN' 98 15 ARG A 105 ? ? 0.306 'SIDE CHAIN' 99 15 ARG A 141 ? ? 0.217 'SIDE CHAIN' 100 15 ARG A 142 ? ? 0.197 'SIDE CHAIN' 101 15 ARG A 145 ? ? 0.146 'SIDE CHAIN' 102 15 ARG A 158 ? ? 0.314 'SIDE CHAIN' 103 15 ARG A 159 ? ? 0.316 'SIDE CHAIN' 104 16 ARG A 99 ? ? 0.279 'SIDE CHAIN' 105 16 ARG A 105 ? ? 0.312 'SIDE CHAIN' 106 16 ARG A 141 ? ? 0.290 'SIDE CHAIN' 107 16 ARG A 142 ? ? 0.318 'SIDE CHAIN' 108 16 ARG A 145 ? ? 0.318 'SIDE CHAIN' 109 16 ARG A 158 ? ? 0.316 'SIDE CHAIN' 110 16 ARG A 159 ? ? 0.285 'SIDE CHAIN' 111 17 ARG A 99 ? ? 0.289 'SIDE CHAIN' 112 17 ARG A 105 ? ? 0.094 'SIDE CHAIN' 113 17 ARG A 141 ? ? 0.208 'SIDE CHAIN' 114 17 ARG A 142 ? ? 0.229 'SIDE CHAIN' 115 17 ARG A 145 ? ? 0.246 'SIDE CHAIN' 116 17 ARG A 158 ? ? 0.208 'SIDE CHAIN' 117 17 ARG A 159 ? ? 0.211 'SIDE CHAIN' 118 18 ARG A 99 ? ? 0.277 'SIDE CHAIN' 119 18 ARG A 141 ? ? 0.270 'SIDE CHAIN' 120 18 ARG A 142 ? ? 0.312 'SIDE CHAIN' 121 18 ARG A 145 ? ? 0.211 'SIDE CHAIN' 122 18 ARG A 158 ? ? 0.163 'SIDE CHAIN' 123 18 ARG A 159 ? ? 0.250 'SIDE CHAIN' 124 19 ARG A 99 ? ? 0.191 'SIDE CHAIN' 125 19 ARG A 105 ? ? 0.298 'SIDE CHAIN' 126 19 ARG A 141 ? ? 0.268 'SIDE CHAIN' 127 19 ARG A 142 ? ? 0.318 'SIDE CHAIN' 128 19 ARG A 145 ? ? 0.242 'SIDE CHAIN' 129 19 ARG A 158 ? ? 0.317 'SIDE CHAIN' 130 19 ARG A 159 ? ? 0.279 'SIDE CHAIN' 131 20 ARG A 99 ? ? 0.255 'SIDE CHAIN' 132 20 ARG A 105 ? ? 0.303 'SIDE CHAIN' 133 20 ARG A 141 ? ? 0.185 'SIDE CHAIN' 134 20 ARG A 142 ? ? 0.275 'SIDE CHAIN' 135 20 ARG A 145 ? ? 0.231 'SIDE CHAIN' 136 20 ARG A 158 ? ? 0.296 'SIDE CHAIN' 137 20 ARG A 159 ? ? 0.262 'SIDE CHAIN' 138 21 ARG A 99 ? ? 0.314 'SIDE CHAIN' 139 21 ARG A 105 ? ? 0.179 'SIDE CHAIN' 140 21 ARG A 141 ? ? 0.316 'SIDE CHAIN' 141 21 ARG A 142 ? ? 0.312 'SIDE CHAIN' 142 21 ARG A 145 ? ? 0.111 'SIDE CHAIN' 143 21 ARG A 158 ? ? 0.204 'SIDE CHAIN' 144 21 ARG A 159 ? ? 0.282 'SIDE CHAIN' 145 22 ARG A 99 ? ? 0.145 'SIDE CHAIN' 146 22 ARG A 105 ? ? 0.310 'SIDE CHAIN' 147 22 ARG A 141 ? ? 0.295 'SIDE CHAIN' 148 22 ARG A 145 ? ? 0.308 'SIDE CHAIN' 149 22 ARG A 158 ? ? 0.084 'SIDE CHAIN' 150 22 ARG A 159 ? ? 0.209 'SIDE CHAIN' 151 23 ARG A 99 ? ? 0.226 'SIDE CHAIN' 152 23 ARG A 105 ? ? 0.196 'SIDE CHAIN' 153 23 ARG A 142 ? ? 0.148 'SIDE CHAIN' 154 23 ARG A 145 ? ? 0.245 'SIDE CHAIN' 155 23 ARG A 158 ? ? 0.267 'SIDE CHAIN' 156 23 ARG A 159 ? ? 0.180 'SIDE CHAIN' 157 24 ARG A 99 ? ? 0.311 'SIDE CHAIN' 158 24 ARG A 105 ? ? 0.268 'SIDE CHAIN' 159 24 ARG A 141 ? ? 0.191 'SIDE CHAIN' 160 24 ARG A 142 ? ? 0.258 'SIDE CHAIN' 161 24 ARG A 145 ? ? 0.314 'SIDE CHAIN' 162 24 ARG A 158 ? ? 0.224 'SIDE CHAIN' 163 24 ARG A 159 ? ? 0.290 'SIDE CHAIN' 164 25 ARG A 99 ? ? 0.214 'SIDE CHAIN' 165 25 ARG A 105 ? ? 0.267 'SIDE CHAIN' 166 25 ARG A 142 ? ? 0.153 'SIDE CHAIN' 167 25 ARG A 145 ? ? 0.301 'SIDE CHAIN' 168 25 ARG A 158 ? ? 0.119 'SIDE CHAIN' 169 25 ARG A 159 ? ? 0.277 'SIDE CHAIN' 170 26 ARG A 99 ? ? 0.219 'SIDE CHAIN' 171 26 ARG A 105 ? ? 0.211 'SIDE CHAIN' 172 26 ARG A 141 ? ? 0.309 'SIDE CHAIN' 173 26 ARG A 142 ? ? 0.162 'SIDE CHAIN' 174 26 ARG A 145 ? ? 0.177 'SIDE CHAIN' 175 26 ARG A 158 ? ? 0.084 'SIDE CHAIN' 176 26 ARG A 159 ? ? 0.272 'SIDE CHAIN' 177 27 ARG A 99 ? ? 0.294 'SIDE CHAIN' 178 27 ARG A 105 ? ? 0.265 'SIDE CHAIN' 179 27 ARG A 141 ? ? 0.202 'SIDE CHAIN' 180 27 ARG A 142 ? ? 0.152 'SIDE CHAIN' 181 27 ARG A 145 ? ? 0.149 'SIDE CHAIN' 182 27 ARG A 158 ? ? 0.308 'SIDE CHAIN' 183 27 ARG A 159 ? ? 0.154 'SIDE CHAIN' 184 28 ARG A 99 ? ? 0.184 'SIDE CHAIN' 185 28 ARG A 105 ? ? 0.237 'SIDE CHAIN' 186 28 ARG A 141 ? ? 0.194 'SIDE CHAIN' 187 28 ARG A 142 ? ? 0.215 'SIDE CHAIN' 188 28 ARG A 145 ? ? 0.118 'SIDE CHAIN' 189 28 ARG A 158 ? ? 0.162 'SIDE CHAIN' 190 28 ARG A 159 ? ? 0.298 'SIDE CHAIN' 191 29 ARG A 99 ? ? 0.273 'SIDE CHAIN' 192 29 ARG A 105 ? ? 0.182 'SIDE CHAIN' 193 29 ARG A 141 ? ? 0.255 'SIDE CHAIN' 194 29 ARG A 142 ? ? 0.291 'SIDE CHAIN' 195 29 ARG A 145 ? ? 0.297 'SIDE CHAIN' 196 29 ARG A 158 ? ? 0.185 'SIDE CHAIN' 197 29 ARG A 159 ? ? 0.298 'SIDE CHAIN' 198 30 ARG A 99 ? ? 0.198 'SIDE CHAIN' 199 30 ARG A 105 ? ? 0.284 'SIDE CHAIN' 200 30 ARG A 141 ? ? 0.317 'SIDE CHAIN' 201 30 ARG A 142 ? ? 0.239 'SIDE CHAIN' 202 30 ARG A 145 ? ? 0.101 'SIDE CHAIN' 203 30 ARG A 158 ? ? 0.299 'SIDE CHAIN' 204 30 ARG A 159 ? ? 0.306 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1TBO _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_refine.entry_id 1TBO _pdbx_nmr_refine.method DG-SA _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' X-PLOR ? ? 1 refinement X-PLOR ? ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 92 ? A GLY 1 2 1 Y 1 A PRO 93 ? A PRO 2 3 1 Y 1 A GLY 160 ? A GLY 69 4 1 Y 1 A ARG 161 ? A ARG 70 5 1 Y 1 A LEU 162 ? A LEU 71 6 1 Y 1 A GLN 163 ? A GLN 72 7 1 Y 1 A LEU 164 ? A LEU 73 8 1 Y 1 A GLU 165 ? A GLU 74 9 1 Y 1 A ILE 166 ? A ILE 75 10 1 Y 1 A ARG 167 ? A ARG 76 11 1 Y 1 A ALA 168 ? A ALA 77 12 1 Y 1 A PRO 169 ? A PRO 78 13 1 Y 1 A THR 170 ? A THR 79 14 1 Y 1 A SER 171 ? A SER 80 15 1 Y 1 A ASP 172 ? A ASP 81 16 1 Y 1 A GLU 173 ? A GLU 82 17 2 Y 1 A GLY 92 ? A GLY 1 18 2 Y 1 A PRO 93 ? A PRO 2 19 2 Y 1 A GLY 160 ? A GLY 69 20 2 Y 1 A ARG 161 ? A ARG 70 21 2 Y 1 A LEU 162 ? A LEU 71 22 2 Y 1 A GLN 163 ? A GLN 72 23 2 Y 1 A LEU 164 ? A LEU 73 24 2 Y 1 A GLU 165 ? A GLU 74 25 2 Y 1 A ILE 166 ? A ILE 75 26 2 Y 1 A ARG 167 ? A ARG 76 27 2 Y 1 A ALA 168 ? A ALA 77 28 2 Y 1 A PRO 169 ? A PRO 78 29 2 Y 1 A THR 170 ? A THR 79 30 2 Y 1 A SER 171 ? A SER 80 31 2 Y 1 A ASP 172 ? A ASP 81 32 2 Y 1 A GLU 173 ? A GLU 82 33 3 Y 1 A GLY 92 ? A GLY 1 34 3 Y 1 A PRO 93 ? A PRO 2 35 3 Y 1 A GLY 160 ? A GLY 69 36 3 Y 1 A ARG 161 ? A ARG 70 37 3 Y 1 A LEU 162 ? A LEU 71 38 3 Y 1 A GLN 163 ? A GLN 72 39 3 Y 1 A LEU 164 ? A LEU 73 40 3 Y 1 A GLU 165 ? A GLU 74 41 3 Y 1 A ILE 166 ? A ILE 75 42 3 Y 1 A ARG 167 ? A ARG 76 43 3 Y 1 A ALA 168 ? A ALA 77 44 3 Y 1 A PRO 169 ? A PRO 78 45 3 Y 1 A THR 170 ? A THR 79 46 3 Y 1 A SER 171 ? A SER 80 47 3 Y 1 A ASP 172 ? A ASP 81 48 3 Y 1 A GLU 173 ? A GLU 82 49 4 Y 1 A GLY 92 ? A GLY 1 50 4 Y 1 A PRO 93 ? A PRO 2 51 4 Y 1 A GLY 160 ? A GLY 69 52 4 Y 1 A ARG 161 ? A ARG 70 53 4 Y 1 A LEU 162 ? A LEU 71 54 4 Y 1 A GLN 163 ? A GLN 72 55 4 Y 1 A LEU 164 ? A LEU 73 56 4 Y 1 A GLU 165 ? A GLU 74 57 4 Y 1 A ILE 166 ? A ILE 75 58 4 Y 1 A ARG 167 ? A ARG 76 59 4 Y 1 A ALA 168 ? A ALA 77 60 4 Y 1 A PRO 169 ? A PRO 78 61 4 Y 1 A THR 170 ? A THR 79 62 4 Y 1 A SER 171 ? A SER 80 63 4 Y 1 A ASP 172 ? A ASP 81 64 4 Y 1 A GLU 173 ? A GLU 82 65 5 Y 1 A GLY 92 ? A GLY 1 66 5 Y 1 A PRO 93 ? A PRO 2 67 5 Y 1 A GLY 160 ? A GLY 69 68 5 Y 1 A ARG 161 ? A ARG 70 69 5 Y 1 A LEU 162 ? A LEU 71 70 5 Y 1 A GLN 163 ? A GLN 72 71 5 Y 1 A LEU 164 ? A LEU 73 72 5 Y 1 A GLU 165 ? A GLU 74 73 5 Y 1 A ILE 166 ? A ILE 75 74 5 Y 1 A ARG 167 ? A ARG 76 75 5 Y 1 A ALA 168 ? A ALA 77 76 5 Y 1 A PRO 169 ? A PRO 78 77 5 Y 1 A THR 170 ? A THR 79 78 5 Y 1 A SER 171 ? A SER 80 79 5 Y 1 A ASP 172 ? A ASP 81 80 5 Y 1 A GLU 173 ? A GLU 82 81 6 Y 1 A GLY 92 ? A GLY 1 82 6 Y 1 A PRO 93 ? A PRO 2 83 6 Y 1 A GLY 160 ? A GLY 69 84 6 Y 1 A ARG 161 ? A ARG 70 85 6 Y 1 A LEU 162 ? A LEU 71 86 6 Y 1 A GLN 163 ? A GLN 72 87 6 Y 1 A LEU 164 ? A LEU 73 88 6 Y 1 A GLU 165 ? A GLU 74 89 6 Y 1 A ILE 166 ? A ILE 75 90 6 Y 1 A ARG 167 ? A ARG 76 91 6 Y 1 A ALA 168 ? A ALA 77 92 6 Y 1 A PRO 169 ? A PRO 78 93 6 Y 1 A THR 170 ? A THR 79 94 6 Y 1 A SER 171 ? A SER 80 95 6 Y 1 A ASP 172 ? A ASP 81 96 6 Y 1 A GLU 173 ? A GLU 82 97 7 Y 1 A GLY 92 ? A GLY 1 98 7 Y 1 A PRO 93 ? A PRO 2 99 7 Y 1 A GLY 160 ? A GLY 69 100 7 Y 1 A ARG 161 ? A ARG 70 101 7 Y 1 A LEU 162 ? A LEU 71 102 7 Y 1 A GLN 163 ? A GLN 72 103 7 Y 1 A LEU 164 ? A LEU 73 104 7 Y 1 A GLU 165 ? A GLU 74 105 7 Y 1 A ILE 166 ? A ILE 75 106 7 Y 1 A ARG 167 ? A ARG 76 107 7 Y 1 A ALA 168 ? A ALA 77 108 7 Y 1 A PRO 169 ? A PRO 78 109 7 Y 1 A THR 170 ? A THR 79 110 7 Y 1 A SER 171 ? A SER 80 111 7 Y 1 A ASP 172 ? A ASP 81 112 7 Y 1 A GLU 173 ? A GLU 82 113 8 Y 1 A GLY 92 ? A GLY 1 114 8 Y 1 A PRO 93 ? A PRO 2 115 8 Y 1 A GLY 160 ? A GLY 69 116 8 Y 1 A ARG 161 ? A ARG 70 117 8 Y 1 A LEU 162 ? A LEU 71 118 8 Y 1 A GLN 163 ? A GLN 72 119 8 Y 1 A LEU 164 ? A LEU 73 120 8 Y 1 A GLU 165 ? A GLU 74 121 8 Y 1 A ILE 166 ? A ILE 75 122 8 Y 1 A ARG 167 ? A ARG 76 123 8 Y 1 A ALA 168 ? A ALA 77 124 8 Y 1 A PRO 169 ? A PRO 78 125 8 Y 1 A THR 170 ? A THR 79 126 8 Y 1 A SER 171 ? A SER 80 127 8 Y 1 A ASP 172 ? A ASP 81 128 8 Y 1 A GLU 173 ? A GLU 82 129 9 Y 1 A GLY 92 ? A GLY 1 130 9 Y 1 A PRO 93 ? A PRO 2 131 9 Y 1 A GLY 160 ? A GLY 69 132 9 Y 1 A ARG 161 ? A ARG 70 133 9 Y 1 A LEU 162 ? A LEU 71 134 9 Y 1 A GLN 163 ? A GLN 72 135 9 Y 1 A LEU 164 ? A LEU 73 136 9 Y 1 A GLU 165 ? A GLU 74 137 9 Y 1 A ILE 166 ? A ILE 75 138 9 Y 1 A ARG 167 ? A ARG 76 139 9 Y 1 A ALA 168 ? A ALA 77 140 9 Y 1 A PRO 169 ? A PRO 78 141 9 Y 1 A THR 170 ? A THR 79 142 9 Y 1 A SER 171 ? A SER 80 143 9 Y 1 A ASP 172 ? A ASP 81 144 9 Y 1 A GLU 173 ? A GLU 82 145 10 Y 1 A GLY 92 ? A GLY 1 146 10 Y 1 A PRO 93 ? A PRO 2 147 10 Y 1 A GLY 160 ? A GLY 69 148 10 Y 1 A ARG 161 ? A ARG 70 149 10 Y 1 A LEU 162 ? A LEU 71 150 10 Y 1 A GLN 163 ? A GLN 72 151 10 Y 1 A LEU 164 ? A LEU 73 152 10 Y 1 A GLU 165 ? A GLU 74 153 10 Y 1 A ILE 166 ? A ILE 75 154 10 Y 1 A ARG 167 ? A ARG 76 155 10 Y 1 A ALA 168 ? A ALA 77 156 10 Y 1 A PRO 169 ? A PRO 78 157 10 Y 1 A THR 170 ? A THR 79 158 10 Y 1 A SER 171 ? A SER 80 159 10 Y 1 A ASP 172 ? A ASP 81 160 10 Y 1 A GLU 173 ? A GLU 82 161 11 Y 1 A GLY 92 ? A GLY 1 162 11 Y 1 A PRO 93 ? A PRO 2 163 11 Y 1 A GLY 160 ? A GLY 69 164 11 Y 1 A ARG 161 ? A ARG 70 165 11 Y 1 A LEU 162 ? A LEU 71 166 11 Y 1 A GLN 163 ? A GLN 72 167 11 Y 1 A LEU 164 ? A LEU 73 168 11 Y 1 A GLU 165 ? A GLU 74 169 11 Y 1 A ILE 166 ? A ILE 75 170 11 Y 1 A ARG 167 ? A ARG 76 171 11 Y 1 A ALA 168 ? A ALA 77 172 11 Y 1 A PRO 169 ? A PRO 78 173 11 Y 1 A THR 170 ? A THR 79 174 11 Y 1 A SER 171 ? A SER 80 175 11 Y 1 A ASP 172 ? A ASP 81 176 11 Y 1 A GLU 173 ? A GLU 82 177 12 Y 1 A GLY 92 ? A GLY 1 178 12 Y 1 A PRO 93 ? A PRO 2 179 12 Y 1 A GLY 160 ? A GLY 69 180 12 Y 1 A ARG 161 ? A ARG 70 181 12 Y 1 A LEU 162 ? A LEU 71 182 12 Y 1 A GLN 163 ? A GLN 72 183 12 Y 1 A LEU 164 ? A LEU 73 184 12 Y 1 A GLU 165 ? A GLU 74 185 12 Y 1 A ILE 166 ? A ILE 75 186 12 Y 1 A ARG 167 ? A ARG 76 187 12 Y 1 A ALA 168 ? A ALA 77 188 12 Y 1 A PRO 169 ? A PRO 78 189 12 Y 1 A THR 170 ? A THR 79 190 12 Y 1 A SER 171 ? A SER 80 191 12 Y 1 A ASP 172 ? A ASP 81 192 12 Y 1 A GLU 173 ? A GLU 82 193 13 Y 1 A GLY 92 ? A GLY 1 194 13 Y 1 A PRO 93 ? A PRO 2 195 13 Y 1 A GLY 160 ? A GLY 69 196 13 Y 1 A ARG 161 ? A ARG 70 197 13 Y 1 A LEU 162 ? A LEU 71 198 13 Y 1 A GLN 163 ? A GLN 72 199 13 Y 1 A LEU 164 ? A LEU 73 200 13 Y 1 A GLU 165 ? A GLU 74 201 13 Y 1 A ILE 166 ? A ILE 75 202 13 Y 1 A ARG 167 ? A ARG 76 203 13 Y 1 A ALA 168 ? A ALA 77 204 13 Y 1 A PRO 169 ? A PRO 78 205 13 Y 1 A THR 170 ? A THR 79 206 13 Y 1 A SER 171 ? A SER 80 207 13 Y 1 A ASP 172 ? A ASP 81 208 13 Y 1 A GLU 173 ? A GLU 82 209 14 Y 1 A GLY 92 ? A GLY 1 210 14 Y 1 A PRO 93 ? A PRO 2 211 14 Y 1 A GLY 160 ? A GLY 69 212 14 Y 1 A ARG 161 ? A ARG 70 213 14 Y 1 A LEU 162 ? A LEU 71 214 14 Y 1 A GLN 163 ? A GLN 72 215 14 Y 1 A LEU 164 ? A LEU 73 216 14 Y 1 A GLU 165 ? A GLU 74 217 14 Y 1 A ILE 166 ? A ILE 75 218 14 Y 1 A ARG 167 ? A ARG 76 219 14 Y 1 A ALA 168 ? A ALA 77 220 14 Y 1 A PRO 169 ? A PRO 78 221 14 Y 1 A THR 170 ? A THR 79 222 14 Y 1 A SER 171 ? A SER 80 223 14 Y 1 A ASP 172 ? A ASP 81 224 14 Y 1 A GLU 173 ? A GLU 82 225 15 Y 1 A GLY 92 ? A GLY 1 226 15 Y 1 A PRO 93 ? A PRO 2 227 15 Y 1 A GLY 160 ? A GLY 69 228 15 Y 1 A ARG 161 ? A ARG 70 229 15 Y 1 A LEU 162 ? A LEU 71 230 15 Y 1 A GLN 163 ? A GLN 72 231 15 Y 1 A LEU 164 ? A LEU 73 232 15 Y 1 A GLU 165 ? A GLU 74 233 15 Y 1 A ILE 166 ? A ILE 75 234 15 Y 1 A ARG 167 ? A ARG 76 235 15 Y 1 A ALA 168 ? A ALA 77 236 15 Y 1 A PRO 169 ? A PRO 78 237 15 Y 1 A THR 170 ? A THR 79 238 15 Y 1 A SER 171 ? A SER 80 239 15 Y 1 A ASP 172 ? A ASP 81 240 15 Y 1 A GLU 173 ? A GLU 82 241 16 Y 1 A GLY 92 ? A GLY 1 242 16 Y 1 A PRO 93 ? A PRO 2 243 16 Y 1 A GLY 160 ? A GLY 69 244 16 Y 1 A ARG 161 ? A ARG 70 245 16 Y 1 A LEU 162 ? A LEU 71 246 16 Y 1 A GLN 163 ? A GLN 72 247 16 Y 1 A LEU 164 ? A LEU 73 248 16 Y 1 A GLU 165 ? A GLU 74 249 16 Y 1 A ILE 166 ? A ILE 75 250 16 Y 1 A ARG 167 ? A ARG 76 251 16 Y 1 A ALA 168 ? A ALA 77 252 16 Y 1 A PRO 169 ? A PRO 78 253 16 Y 1 A THR 170 ? A THR 79 254 16 Y 1 A SER 171 ? A SER 80 255 16 Y 1 A ASP 172 ? A ASP 81 256 16 Y 1 A GLU 173 ? A GLU 82 257 17 Y 1 A GLY 92 ? A GLY 1 258 17 Y 1 A PRO 93 ? A PRO 2 259 17 Y 1 A GLY 160 ? A GLY 69 260 17 Y 1 A ARG 161 ? A ARG 70 261 17 Y 1 A LEU 162 ? A LEU 71 262 17 Y 1 A GLN 163 ? A GLN 72 263 17 Y 1 A LEU 164 ? A LEU 73 264 17 Y 1 A GLU 165 ? A GLU 74 265 17 Y 1 A ILE 166 ? A ILE 75 266 17 Y 1 A ARG 167 ? A ARG 76 267 17 Y 1 A ALA 168 ? A ALA 77 268 17 Y 1 A PRO 169 ? A PRO 78 269 17 Y 1 A THR 170 ? A THR 79 270 17 Y 1 A SER 171 ? A SER 80 271 17 Y 1 A ASP 172 ? A ASP 81 272 17 Y 1 A GLU 173 ? A GLU 82 273 18 Y 1 A GLY 92 ? A GLY 1 274 18 Y 1 A PRO 93 ? A PRO 2 275 18 Y 1 A GLY 160 ? A GLY 69 276 18 Y 1 A ARG 161 ? A ARG 70 277 18 Y 1 A LEU 162 ? A LEU 71 278 18 Y 1 A GLN 163 ? A GLN 72 279 18 Y 1 A LEU 164 ? A LEU 73 280 18 Y 1 A GLU 165 ? A GLU 74 281 18 Y 1 A ILE 166 ? A ILE 75 282 18 Y 1 A ARG 167 ? A ARG 76 283 18 Y 1 A ALA 168 ? A ALA 77 284 18 Y 1 A PRO 169 ? A PRO 78 285 18 Y 1 A THR 170 ? A THR 79 286 18 Y 1 A SER 171 ? A SER 80 287 18 Y 1 A ASP 172 ? A ASP 81 288 18 Y 1 A GLU 173 ? A GLU 82 289 19 Y 1 A GLY 92 ? A GLY 1 290 19 Y 1 A PRO 93 ? A PRO 2 291 19 Y 1 A GLY 160 ? A GLY 69 292 19 Y 1 A ARG 161 ? A ARG 70 293 19 Y 1 A LEU 162 ? A LEU 71 294 19 Y 1 A GLN 163 ? A GLN 72 295 19 Y 1 A LEU 164 ? A LEU 73 296 19 Y 1 A GLU 165 ? A GLU 74 297 19 Y 1 A ILE 166 ? A ILE 75 298 19 Y 1 A ARG 167 ? A ARG 76 299 19 Y 1 A ALA 168 ? A ALA 77 300 19 Y 1 A PRO 169 ? A PRO 78 301 19 Y 1 A THR 170 ? A THR 79 302 19 Y 1 A SER 171 ? A SER 80 303 19 Y 1 A ASP 172 ? A ASP 81 304 19 Y 1 A GLU 173 ? A GLU 82 305 20 Y 1 A GLY 92 ? A GLY 1 306 20 Y 1 A PRO 93 ? A PRO 2 307 20 Y 1 A GLY 160 ? A GLY 69 308 20 Y 1 A ARG 161 ? A ARG 70 309 20 Y 1 A LEU 162 ? A LEU 71 310 20 Y 1 A GLN 163 ? A GLN 72 311 20 Y 1 A LEU 164 ? A LEU 73 312 20 Y 1 A GLU 165 ? A GLU 74 313 20 Y 1 A ILE 166 ? A ILE 75 314 20 Y 1 A ARG 167 ? A ARG 76 315 20 Y 1 A ALA 168 ? A ALA 77 316 20 Y 1 A PRO 169 ? A PRO 78 317 20 Y 1 A THR 170 ? A THR 79 318 20 Y 1 A SER 171 ? A SER 80 319 20 Y 1 A ASP 172 ? A ASP 81 320 20 Y 1 A GLU 173 ? A GLU 82 321 21 Y 1 A GLY 92 ? A GLY 1 322 21 Y 1 A PRO 93 ? A PRO 2 323 21 Y 1 A GLY 160 ? A GLY 69 324 21 Y 1 A ARG 161 ? A ARG 70 325 21 Y 1 A LEU 162 ? A LEU 71 326 21 Y 1 A GLN 163 ? A GLN 72 327 21 Y 1 A LEU 164 ? A LEU 73 328 21 Y 1 A GLU 165 ? A GLU 74 329 21 Y 1 A ILE 166 ? A ILE 75 330 21 Y 1 A ARG 167 ? A ARG 76 331 21 Y 1 A ALA 168 ? A ALA 77 332 21 Y 1 A PRO 169 ? A PRO 78 333 21 Y 1 A THR 170 ? A THR 79 334 21 Y 1 A SER 171 ? A SER 80 335 21 Y 1 A ASP 172 ? A ASP 81 336 21 Y 1 A GLU 173 ? A GLU 82 337 22 Y 1 A GLY 92 ? A GLY 1 338 22 Y 1 A PRO 93 ? A PRO 2 339 22 Y 1 A GLY 160 ? A GLY 69 340 22 Y 1 A ARG 161 ? A ARG 70 341 22 Y 1 A LEU 162 ? A LEU 71 342 22 Y 1 A GLN 163 ? A GLN 72 343 22 Y 1 A LEU 164 ? A LEU 73 344 22 Y 1 A GLU 165 ? A GLU 74 345 22 Y 1 A ILE 166 ? A ILE 75 346 22 Y 1 A ARG 167 ? A ARG 76 347 22 Y 1 A ALA 168 ? A ALA 77 348 22 Y 1 A PRO 169 ? A PRO 78 349 22 Y 1 A THR 170 ? A THR 79 350 22 Y 1 A SER 171 ? A SER 80 351 22 Y 1 A ASP 172 ? A ASP 81 352 22 Y 1 A GLU 173 ? A GLU 82 353 23 Y 1 A GLY 92 ? A GLY 1 354 23 Y 1 A PRO 93 ? A PRO 2 355 23 Y 1 A GLY 160 ? A GLY 69 356 23 Y 1 A ARG 161 ? A ARG 70 357 23 Y 1 A LEU 162 ? A LEU 71 358 23 Y 1 A GLN 163 ? A GLN 72 359 23 Y 1 A LEU 164 ? A LEU 73 360 23 Y 1 A GLU 165 ? A GLU 74 361 23 Y 1 A ILE 166 ? A ILE 75 362 23 Y 1 A ARG 167 ? A ARG 76 363 23 Y 1 A ALA 168 ? A ALA 77 364 23 Y 1 A PRO 169 ? A PRO 78 365 23 Y 1 A THR 170 ? A THR 79 366 23 Y 1 A SER 171 ? A SER 80 367 23 Y 1 A ASP 172 ? A ASP 81 368 23 Y 1 A GLU 173 ? A GLU 82 369 24 Y 1 A GLY 92 ? A GLY 1 370 24 Y 1 A PRO 93 ? A PRO 2 371 24 Y 1 A GLY 160 ? A GLY 69 372 24 Y 1 A ARG 161 ? A ARG 70 373 24 Y 1 A LEU 162 ? A LEU 71 374 24 Y 1 A GLN 163 ? A GLN 72 375 24 Y 1 A LEU 164 ? A LEU 73 376 24 Y 1 A GLU 165 ? A GLU 74 377 24 Y 1 A ILE 166 ? A ILE 75 378 24 Y 1 A ARG 167 ? A ARG 76 379 24 Y 1 A ALA 168 ? A ALA 77 380 24 Y 1 A PRO 169 ? A PRO 78 381 24 Y 1 A THR 170 ? A THR 79 382 24 Y 1 A SER 171 ? A SER 80 383 24 Y 1 A ASP 172 ? A ASP 81 384 24 Y 1 A GLU 173 ? A GLU 82 385 25 Y 1 A GLY 92 ? A GLY 1 386 25 Y 1 A PRO 93 ? A PRO 2 387 25 Y 1 A GLY 160 ? A GLY 69 388 25 Y 1 A ARG 161 ? A ARG 70 389 25 Y 1 A LEU 162 ? A LEU 71 390 25 Y 1 A GLN 163 ? A GLN 72 391 25 Y 1 A LEU 164 ? A LEU 73 392 25 Y 1 A GLU 165 ? A GLU 74 393 25 Y 1 A ILE 166 ? A ILE 75 394 25 Y 1 A ARG 167 ? A ARG 76 395 25 Y 1 A ALA 168 ? A ALA 77 396 25 Y 1 A PRO 169 ? A PRO 78 397 25 Y 1 A THR 170 ? A THR 79 398 25 Y 1 A SER 171 ? A SER 80 399 25 Y 1 A ASP 172 ? A ASP 81 400 25 Y 1 A GLU 173 ? A GLU 82 401 26 Y 1 A GLY 92 ? A GLY 1 402 26 Y 1 A PRO 93 ? A PRO 2 403 26 Y 1 A GLY 160 ? A GLY 69 404 26 Y 1 A ARG 161 ? A ARG 70 405 26 Y 1 A LEU 162 ? A LEU 71 406 26 Y 1 A GLN 163 ? A GLN 72 407 26 Y 1 A LEU 164 ? A LEU 73 408 26 Y 1 A GLU 165 ? A GLU 74 409 26 Y 1 A ILE 166 ? A ILE 75 410 26 Y 1 A ARG 167 ? A ARG 76 411 26 Y 1 A ALA 168 ? A ALA 77 412 26 Y 1 A PRO 169 ? A PRO 78 413 26 Y 1 A THR 170 ? A THR 79 414 26 Y 1 A SER 171 ? A SER 80 415 26 Y 1 A ASP 172 ? A ASP 81 416 26 Y 1 A GLU 173 ? A GLU 82 417 27 Y 1 A GLY 92 ? A GLY 1 418 27 Y 1 A PRO 93 ? A PRO 2 419 27 Y 1 A GLY 160 ? A GLY 69 420 27 Y 1 A ARG 161 ? A ARG 70 421 27 Y 1 A LEU 162 ? A LEU 71 422 27 Y 1 A GLN 163 ? A GLN 72 423 27 Y 1 A LEU 164 ? A LEU 73 424 27 Y 1 A GLU 165 ? A GLU 74 425 27 Y 1 A ILE 166 ? A ILE 75 426 27 Y 1 A ARG 167 ? A ARG 76 427 27 Y 1 A ALA 168 ? A ALA 77 428 27 Y 1 A PRO 169 ? A PRO 78 429 27 Y 1 A THR 170 ? A THR 79 430 27 Y 1 A SER 171 ? A SER 80 431 27 Y 1 A ASP 172 ? A ASP 81 432 27 Y 1 A GLU 173 ? A GLU 82 433 28 Y 1 A GLY 92 ? A GLY 1 434 28 Y 1 A PRO 93 ? A PRO 2 435 28 Y 1 A GLY 160 ? A GLY 69 436 28 Y 1 A ARG 161 ? A ARG 70 437 28 Y 1 A LEU 162 ? A LEU 71 438 28 Y 1 A GLN 163 ? A GLN 72 439 28 Y 1 A LEU 164 ? A LEU 73 440 28 Y 1 A GLU 165 ? A GLU 74 441 28 Y 1 A ILE 166 ? A ILE 75 442 28 Y 1 A ARG 167 ? A ARG 76 443 28 Y 1 A ALA 168 ? A ALA 77 444 28 Y 1 A PRO 169 ? A PRO 78 445 28 Y 1 A THR 170 ? A THR 79 446 28 Y 1 A SER 171 ? A SER 80 447 28 Y 1 A ASP 172 ? A ASP 81 448 28 Y 1 A GLU 173 ? A GLU 82 449 29 Y 1 A GLY 92 ? A GLY 1 450 29 Y 1 A PRO 93 ? A PRO 2 451 29 Y 1 A GLY 160 ? A GLY 69 452 29 Y 1 A ARG 161 ? A ARG 70 453 29 Y 1 A LEU 162 ? A LEU 71 454 29 Y 1 A GLN 163 ? A GLN 72 455 29 Y 1 A LEU 164 ? A LEU 73 456 29 Y 1 A GLU 165 ? A GLU 74 457 29 Y 1 A ILE 166 ? A ILE 75 458 29 Y 1 A ARG 167 ? A ARG 76 459 29 Y 1 A ALA 168 ? A ALA 77 460 29 Y 1 A PRO 169 ? A PRO 78 461 29 Y 1 A THR 170 ? A THR 79 462 29 Y 1 A SER 171 ? A SER 80 463 29 Y 1 A ASP 172 ? A ASP 81 464 29 Y 1 A GLU 173 ? A GLU 82 465 30 Y 1 A GLY 92 ? A GLY 1 466 30 Y 1 A PRO 93 ? A PRO 2 467 30 Y 1 A GLY 160 ? A GLY 69 468 30 Y 1 A ARG 161 ? A ARG 70 469 30 Y 1 A LEU 162 ? A LEU 71 470 30 Y 1 A GLN 163 ? A GLN 72 471 30 Y 1 A LEU 164 ? A LEU 73 472 30 Y 1 A GLU 165 ? A GLU 74 473 30 Y 1 A ILE 166 ? A ILE 75 474 30 Y 1 A ARG 167 ? A ARG 76 475 30 Y 1 A ALA 168 ? A ALA 77 476 30 Y 1 A PRO 169 ? A PRO 78 477 30 Y 1 A THR 170 ? A THR 79 478 30 Y 1 A SER 171 ? A SER 80 479 30 Y 1 A ASP 172 ? A ASP 81 480 30 Y 1 A GLU 173 ? A GLU 82 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1TBO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_