data_1TI1
# 
_entry.id   1TI1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1TI1         pdb_00001ti1 10.2210/pdb1ti1/pdb 
RCSB  RCSB022653   ?            ?                   
WWPDB D_1000022653 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-05-03 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
5 'Structure model' 1 4 2023-08-23 
6 'Structure model' 1 5 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Refinement description'    
8 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2                    
2 4 'Structure model' struct_ref_seq_dif            
3 4 'Structure model' struct_site                   
4 5 'Structure model' chem_comp_atom                
5 5 'Structure model' chem_comp_bond                
6 5 'Structure model' pdbx_initial_refinement_model 
7 6 'Structure model' pdbx_entry_details            
8 6 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TI1 
_pdbx_database_status.recvd_initial_deposition_date   2004-06-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1DSB 'Crystal structure of the DsbA protein required for disulphide bond formation in vivo.' unspecified 
PDB 1FVK 'The 1.7 Angstrom Structure Of Wild Type Disulfide Bond Formation Protein (Dsba)'       unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kone, A.'  1 
'Serre, L.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Intriguing conformation changes associated with the trans/cis isomerization of a prolyl residue in the active site of the DsbA C33A mutant.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            347 
_citation.page_first                555 
_citation.page_last                 563 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15755450 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.01.049 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ondo-Mbele, E.' 1 ? 
primary 'Vives, C.'      2 ? 
primary 'Kone, A.'       3 ? 
primary 'Serre, L.'      4 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thiol:disulfide interchange protein dsbA' 21122.959 1  ? C33A ? ? 
2 non-polymer syn DODECANE                                   170.335   1  ? ?    ? ? 
3 water       nat water                                      18.015    13 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM
ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ
LNPQGMDTSNMDVFVQQYADTVKYLSEKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM
ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ
LNPQGMDTSNMDVFVQQYADTVKYLSEKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 DODECANE D12 
3 water    HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLN n 
1 3   TYR n 
1 4   GLU n 
1 5   ASP n 
1 6   GLY n 
1 7   LYS n 
1 8   GLN n 
1 9   TYR n 
1 10  THR n 
1 11  THR n 
1 12  LEU n 
1 13  GLU n 
1 14  LYS n 
1 15  PRO n 
1 16  VAL n 
1 17  ALA n 
1 18  GLY n 
1 19  ALA n 
1 20  PRO n 
1 21  GLN n 
1 22  VAL n 
1 23  LEU n 
1 24  GLU n 
1 25  PHE n 
1 26  PHE n 
1 27  SER n 
1 28  PHE n 
1 29  PHE n 
1 30  CYS n 
1 31  PRO n 
1 32  HIS n 
1 33  ALA n 
1 34  TYR n 
1 35  GLN n 
1 36  PHE n 
1 37  GLU n 
1 38  GLU n 
1 39  VAL n 
1 40  LEU n 
1 41  HIS n 
1 42  ILE n 
1 43  SER n 
1 44  ASP n 
1 45  ASN n 
1 46  VAL n 
1 47  LYS n 
1 48  LYS n 
1 49  LYS n 
1 50  LEU n 
1 51  PRO n 
1 52  GLU n 
1 53  GLY n 
1 54  VAL n 
1 55  LYS n 
1 56  MET n 
1 57  THR n 
1 58  LYS n 
1 59  TYR n 
1 60  HIS n 
1 61  VAL n 
1 62  ASN n 
1 63  PHE n 
1 64  MET n 
1 65  GLY n 
1 66  GLY n 
1 67  ASP n 
1 68  LEU n 
1 69  GLY n 
1 70  LYS n 
1 71  ASP n 
1 72  LEU n 
1 73  THR n 
1 74  GLN n 
1 75  ALA n 
1 76  TRP n 
1 77  ALA n 
1 78  VAL n 
1 79  ALA n 
1 80  MET n 
1 81  ALA n 
1 82  LEU n 
1 83  GLY n 
1 84  VAL n 
1 85  GLU n 
1 86  ASP n 
1 87  LYS n 
1 88  VAL n 
1 89  THR n 
1 90  VAL n 
1 91  PRO n 
1 92  LEU n 
1 93  PHE n 
1 94  GLU n 
1 95  GLY n 
1 96  VAL n 
1 97  GLN n 
1 98  LYS n 
1 99  THR n 
1 100 GLN n 
1 101 THR n 
1 102 ILE n 
1 103 ARG n 
1 104 SER n 
1 105 ALA n 
1 106 SER n 
1 107 ASP n 
1 108 ILE n 
1 109 ARG n 
1 110 ASP n 
1 111 VAL n 
1 112 PHE n 
1 113 ILE n 
1 114 ASN n 
1 115 ALA n 
1 116 GLY n 
1 117 ILE n 
1 118 LYS n 
1 119 GLY n 
1 120 GLU n 
1 121 GLU n 
1 122 TYR n 
1 123 ASP n 
1 124 ALA n 
1 125 ALA n 
1 126 TRP n 
1 127 ASN n 
1 128 SER n 
1 129 PHE n 
1 130 VAL n 
1 131 VAL n 
1 132 LYS n 
1 133 SER n 
1 134 LEU n 
1 135 VAL n 
1 136 ALA n 
1 137 GLN n 
1 138 GLN n 
1 139 GLU n 
1 140 LYS n 
1 141 ALA n 
1 142 ALA n 
1 143 ALA n 
1 144 ASP n 
1 145 VAL n 
1 146 GLN n 
1 147 LEU n 
1 148 ARG n 
1 149 GLY n 
1 150 VAL n 
1 151 PRO n 
1 152 ALA n 
1 153 MET n 
1 154 PHE n 
1 155 VAL n 
1 156 ASN n 
1 157 GLY n 
1 158 LYS n 
1 159 TYR n 
1 160 GLN n 
1 161 LEU n 
1 162 ASN n 
1 163 PRO n 
1 164 GLN n 
1 165 GLY n 
1 166 MET n 
1 167 ASP n 
1 168 THR n 
1 169 SER n 
1 170 ASN n 
1 171 MET n 
1 172 ASP n 
1 173 VAL n 
1 174 PHE n 
1 175 VAL n 
1 176 GLN n 
1 177 GLN n 
1 178 TYR n 
1 179 ALA n 
1 180 ASP n 
1 181 THR n 
1 182 VAL n 
1 183 LYS n 
1 184 TYR n 
1 185 LEU n 
1 186 SER n 
1 187 GLU n 
1 188 LYS n 
1 189 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'DSBA, PPFA, DSF, B3860, Z5392, ECS4783' 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    O157:H7 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83334 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
D12 non-polymer         . DODECANE        ? 'C12 H26'        170.335 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   GLN 2   2   ?   ?   ?   A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   GLU 4   4   4   GLU ALA A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   LYS 7   7   7   LYS ALA A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  HIS 41  41  41  HIS HIS A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  GLU 52  52  52  GLU ALA A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  MET 56  56  56  MET MET A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 TRP 126 126 126 TRP TRP A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 GLN 138 138 138 GLN GLN A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 GLN 160 160 160 GLN GLN A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 THR 168 168 168 THR THR A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 MET 171 171 171 MET MET A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 GLN 177 177 177 GLN GLN A . n 
A 1 178 TYR 178 178 178 TYR TYR A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 LYS 189 189 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 D12 1  190 100 D12 D12 A . 
C 3 HOH 1  191 1   HOH HOH A . 
C 3 HOH 2  192 2   HOH HOH A . 
C 3 HOH 3  193 3   HOH HOH A . 
C 3 HOH 4  194 4   HOH HOH A . 
C 3 HOH 5  195 5   HOH HOH A . 
C 3 HOH 6  196 6   HOH HOH A . 
C 3 HOH 7  197 7   HOH HOH A . 
C 3 HOH 8  198 8   HOH HOH A . 
C 3 HOH 9  199 9   HOH HOH A . 
C 3 HOH 10 200 10  HOH HOH A . 
C 3 HOH 11 201 11  HOH HOH A . 
C 3 HOH 12 202 12  HOH HOH A . 
C 3 HOH 13 203 13  HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 4  ? CG  ? A GLU 4  CG  
2  1 Y 1 A GLU 4  ? CD  ? A GLU 4  CD  
3  1 Y 1 A GLU 4  ? OE1 ? A GLU 4  OE1 
4  1 Y 1 A GLU 4  ? OE2 ? A GLU 4  OE2 
5  1 Y 1 A LYS 7  ? CG  ? A LYS 7  CG  
6  1 Y 1 A LYS 7  ? CD  ? A LYS 7  CD  
7  1 Y 1 A LYS 7  ? CE  ? A LYS 7  CE  
8  1 Y 1 A LYS 7  ? NZ  ? A LYS 7  NZ  
9  1 Y 1 A GLU 52 ? CG  ? A GLU 52 CG  
10 1 Y 1 A GLU 52 ? CD  ? A GLU 52 CD  
11 1 Y 1 A GLU 52 ? OE1 ? A GLU 52 OE1 
12 1 Y 1 A GLU 52 ? OE2 ? A GLU 52 OE2 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
AMoRE  phasing          .         ? 3 
CNS    refinement       .         ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
_cell.entry_id           1TI1 
_cell.length_a           57.160 
_cell.length_b           57.160 
_cell.length_c           109.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TI1 
_symmetry.space_group_name_H-M             'P 62' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                171 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.entry_id          1TI1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            281 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG 8000, Bicine, DDM, MPD, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 281K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-12-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    NULL 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1TI1 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.6 
_reflns.d_resolution_low             55 
_reflns.number_all                   6214 
_reflns.number_obs                   6211 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.059 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_netI_over_sigmaI        8.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.242 
_reflns_shell.pdbx_Rsym_value        0.224 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        7.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      931 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1TI1 
_refine.ls_d_res_high                            2.6 
_refine.ls_d_res_low                             20.5 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     6265 
_refine.ls_number_reflns_obs                     6211 
_refine.ls_number_reflns_R_free                  316 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.247 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1DSB' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               56.2 
_refine.aniso_B[1][1]                            0.469 
_refine.aniso_B[1][2]                            -6.391 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][2]                            0.469 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            -0.937 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1451 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               1476 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        20.5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24    ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.02  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.312 
_refine_ls_shell.percent_reflns_obs               99.6 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            0.045 
_refine_ls_shell.percent_reflns_R_free            10 
_refine_ls_shell.number_reflns_R_free             49 
_refine_ls_shell.number_reflns_obs                973 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       protein_rep.param 
_pdbx_xplor_file.topol_file       protein.top 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_database_PDB_matrix.entry_id          1TI1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1TI1 
_struct.title                     'crystal structure of a mutant DsbA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TI1 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'oxidoreductase, proline, thiol, detergent' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DSBA_ECOLI 
_struct_ref.pdbx_db_accession          P24991 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM
ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ
LNPQGMDTSNMDVFVQQYADTVKYLSEKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1TI1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 189 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24991 
_struct_ref_seq.db_align_beg                  20 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  208 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       189 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1TI1 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      33 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P24991 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          33 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            33 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 33  ? LYS A 48  ? ALA A 33  LYS A 48  1 ? 16 
HELX_P HELX_P2 2 GLY A 65  ? GLY A 83  ? GLY A 65  GLY A 83  1 ? 19 
HELX_P HELX_P3 3 VAL A 84  ? GLN A 97  ? VAL A 84  GLN A 97  1 ? 14 
HELX_P HELX_P4 4 SER A 104 ? ASN A 114 ? SER A 104 ASN A 114 1 ? 11 
HELX_P HELX_P5 5 LYS A 118 ? ASN A 127 ? LYS A 118 ASN A 127 1 ? 10 
HELX_P HELX_P6 6 SER A 128 ? VAL A 145 ? SER A 128 VAL A 145 1 ? 18 
HELX_P HELX_P7 7 MET A 171 ? LYS A 188 ? MET A 171 LYS A 188 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            30 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            30 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             30 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             30 
_struct_conn.ptnr2_symmetry                4_565 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.084 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      CYS 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       30 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      30 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       CYS 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        30 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       30 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          4_565 
_pdbx_modification_feature.comp_id_linking_atom               SG 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                . 
_pdbx_modification_feature.ref_pcm_id                         . 
_pdbx_modification_feature.ref_comp_id                        . 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Disulfide bridge' 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 CYS 30  A . ? CYS 30  A PRO 31  A ? PRO 31  A 1 -0.65 
2 VAL 150 A . ? VAL 150 A PRO 151 A ? PRO 151 A 1 0.43  
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 9   ? THR A 11  ? TYR A 9   THR A 11  
A 2 TYR A 159 ? LEU A 161 ? TYR A 159 LEU A 161 
A 3 ALA A 152 ? VAL A 155 ? ALA A 152 VAL A 155 
A 4 VAL A 22  ? PHE A 26  ? VAL A 22  PHE A 26  
A 5 MET A 56  ? HIS A 60  ? MET A 56  HIS A 60  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 10  ? N THR A 10  O GLN A 160 ? O GLN A 160 
A 2 3 O LEU A 161 ? O LEU A 161 N MET A 153 ? N MET A 153 
A 3 4 O PHE A 154 ? O PHE A 154 N LEU A 23  ? N LEU A 23  
A 4 5 N GLU A 24  ? N GLU A 24  O TYR A 59  ? O TYR A 59  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    D12 
_struct_site.pdbx_auth_seq_id     190 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    11 
_struct_site.details              'BINDING SITE FOR RESIDUE D12 A 190' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 GLU A 24  ? GLU A 24  . ? 1_555 ? 
2  AC1 11 HIS A 32  ? HIS A 32  . ? 4_565 ? 
3  AC1 11 ALA A 33  ? ALA A 33  . ? 4_565 ? 
4  AC1 11 TYR A 34  ? TYR A 34  . ? 4_565 ? 
5  AC1 11 VAL A 39  ? VAL A 39  . ? 1_555 ? 
6  AC1 11 ILE A 42  ? ILE A 42  . ? 1_555 ? 
7  AC1 11 SER A 43  ? SER A 43  . ? 1_555 ? 
8  AC1 11 MET A 153 ? MET A 153 . ? 1_555 ? 
9  AC1 11 PRO A 163 ? PRO A 163 . ? 1_555 ? 
10 AC1 11 PHE A 174 ? PHE A 174 . ? 1_555 ? 
11 AC1 11 TYR A 178 ? TYR A 178 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   1TI1 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O  A PHE 63 ? ? 1_555 O   A PHE 63 ? ? 4_565 2.18 
2 1 OH A TYR 34 ? ? 1_555 OE2 A GLU 38 ? ? 4_565 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 4   ? ? 26.60   101.00  
2  1 LYS A 7   ? ? -99.13  -79.89  
3  1 GLU A 13  ? ? -59.35  -4.11   
4  1 LYS A 14  ? ? -169.29 97.46   
5  1 PRO A 15  ? ? -38.55  154.02  
6  1 PRO A 31  ? ? -67.62  -179.78 
7  1 ALA A 33  ? ? 54.87   -113.46 
8  1 LYS A 48  ? ? -74.95  27.30   
9  1 LYS A 49  ? ? -159.23 -6.45   
10 1 PRO A 51  ? ? -36.01  169.24  
11 1 GLU A 52  ? ? 58.24   82.88   
12 1 PHE A 63  ? ? -63.34  20.10   
13 1 GLN A 100 ? ? 34.06   55.27   
14 1 ASN A 114 ? ? -69.73  6.73    
15 1 ASN A 156 ? ? 54.47   8.24    
16 1 LEU A 161 ? ? -48.29  158.82  
17 1 MET A 166 ? ? 179.95  165.89  
18 1 ASP A 167 ? ? -20.09  76.06   
19 1 THR A 168 ? ? -49.85  -90.22  
20 1 SER A 169 ? ? -43.64  176.28  
21 1 ASN A 170 ? ? 58.22   -162.84 
22 1 MET A 171 ? ? -159.24 -35.30  
23 1 TYR A 184 ? ? -38.21  -72.28  
24 1 LEU A 185 ? ? -38.11  -34.86  
25 1 GLU A 187 ? ? -69.76  6.80    
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     203 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 1   ? A ALA 1   
2 1 Y 1 A GLN 2   ? A GLN 2   
3 1 Y 1 A LYS 189 ? A LYS 189 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
D12 C1   C N N 88  
D12 C2   C N N 89  
D12 C3   C N N 90  
D12 C4   C N N 91  
D12 C5   C N N 92  
D12 C6   C N N 93  
D12 C7   C N N 94  
D12 C8   C N N 95  
D12 C9   C N N 96  
D12 C10  C N N 97  
D12 C11  C N N 98  
D12 C12  C N N 99  
D12 H11  H N N 100 
D12 H12  H N N 101 
D12 H13  H N N 102 
D12 H21  H N N 103 
D12 H22  H N N 104 
D12 H31  H N N 105 
D12 H32  H N N 106 
D12 H41  H N N 107 
D12 H42  H N N 108 
D12 H51  H N N 109 
D12 H52  H N N 110 
D12 H61  H N N 111 
D12 H62  H N N 112 
D12 H71  H N N 113 
D12 H72  H N N 114 
D12 H81  H N N 115 
D12 H82  H N N 116 
D12 H91  H N N 117 
D12 H92  H N N 118 
D12 H101 H N N 119 
D12 H102 H N N 120 
D12 H111 H N N 121 
D12 H112 H N N 122 
D12 H121 H N N 123 
D12 H122 H N N 124 
D12 H123 H N N 125 
GLN N    N N N 126 
GLN CA   C N S 127 
GLN C    C N N 128 
GLN O    O N N 129 
GLN CB   C N N 130 
GLN CG   C N N 131 
GLN CD   C N N 132 
GLN OE1  O N N 133 
GLN NE2  N N N 134 
GLN OXT  O N N 135 
GLN H    H N N 136 
GLN H2   H N N 137 
GLN HA   H N N 138 
GLN HB2  H N N 139 
GLN HB3  H N N 140 
GLN HG2  H N N 141 
GLN HG3  H N N 142 
GLN HE21 H N N 143 
GLN HE22 H N N 144 
GLN HXT  H N N 145 
GLU N    N N N 146 
GLU CA   C N S 147 
GLU C    C N N 148 
GLU O    O N N 149 
GLU CB   C N N 150 
GLU CG   C N N 151 
GLU CD   C N N 152 
GLU OE1  O N N 153 
GLU OE2  O N N 154 
GLU OXT  O N N 155 
GLU H    H N N 156 
GLU H2   H N N 157 
GLU HA   H N N 158 
GLU HB2  H N N 159 
GLU HB3  H N N 160 
GLU HG2  H N N 161 
GLU HG3  H N N 162 
GLU HE2  H N N 163 
GLU HXT  H N N 164 
GLY N    N N N 165 
GLY CA   C N N 166 
GLY C    C N N 167 
GLY O    O N N 168 
GLY OXT  O N N 169 
GLY H    H N N 170 
GLY H2   H N N 171 
GLY HA2  H N N 172 
GLY HA3  H N N 173 
GLY HXT  H N N 174 
HIS N    N N N 175 
HIS CA   C N S 176 
HIS C    C N N 177 
HIS O    O N N 178 
HIS CB   C N N 179 
HIS CG   C Y N 180 
HIS ND1  N Y N 181 
HIS CD2  C Y N 182 
HIS CE1  C Y N 183 
HIS NE2  N Y N 184 
HIS OXT  O N N 185 
HIS H    H N N 186 
HIS H2   H N N 187 
HIS HA   H N N 188 
HIS HB2  H N N 189 
HIS HB3  H N N 190 
HIS HD1  H N N 191 
HIS HD2  H N N 192 
HIS HE1  H N N 193 
HIS HE2  H N N 194 
HIS HXT  H N N 195 
HOH O    O N N 196 
HOH H1   H N N 197 
HOH H2   H N N 198 
ILE N    N N N 199 
ILE CA   C N S 200 
ILE C    C N N 201 
ILE O    O N N 202 
ILE CB   C N S 203 
ILE CG1  C N N 204 
ILE CG2  C N N 205 
ILE CD1  C N N 206 
ILE OXT  O N N 207 
ILE H    H N N 208 
ILE H2   H N N 209 
ILE HA   H N N 210 
ILE HB   H N N 211 
ILE HG12 H N N 212 
ILE HG13 H N N 213 
ILE HG21 H N N 214 
ILE HG22 H N N 215 
ILE HG23 H N N 216 
ILE HD11 H N N 217 
ILE HD12 H N N 218 
ILE HD13 H N N 219 
ILE HXT  H N N 220 
LEU N    N N N 221 
LEU CA   C N S 222 
LEU C    C N N 223 
LEU O    O N N 224 
LEU CB   C N N 225 
LEU CG   C N N 226 
LEU CD1  C N N 227 
LEU CD2  C N N 228 
LEU OXT  O N N 229 
LEU H    H N N 230 
LEU H2   H N N 231 
LEU HA   H N N 232 
LEU HB2  H N N 233 
LEU HB3  H N N 234 
LEU HG   H N N 235 
LEU HD11 H N N 236 
LEU HD12 H N N 237 
LEU HD13 H N N 238 
LEU HD21 H N N 239 
LEU HD22 H N N 240 
LEU HD23 H N N 241 
LEU HXT  H N N 242 
LYS N    N N N 243 
LYS CA   C N S 244 
LYS C    C N N 245 
LYS O    O N N 246 
LYS CB   C N N 247 
LYS CG   C N N 248 
LYS CD   C N N 249 
LYS CE   C N N 250 
LYS NZ   N N N 251 
LYS OXT  O N N 252 
LYS H    H N N 253 
LYS H2   H N N 254 
LYS HA   H N N 255 
LYS HB2  H N N 256 
LYS HB3  H N N 257 
LYS HG2  H N N 258 
LYS HG3  H N N 259 
LYS HD2  H N N 260 
LYS HD3  H N N 261 
LYS HE2  H N N 262 
LYS HE3  H N N 263 
LYS HZ1  H N N 264 
LYS HZ2  H N N 265 
LYS HZ3  H N N 266 
LYS HXT  H N N 267 
MET N    N N N 268 
MET CA   C N S 269 
MET C    C N N 270 
MET O    O N N 271 
MET CB   C N N 272 
MET CG   C N N 273 
MET SD   S N N 274 
MET CE   C N N 275 
MET OXT  O N N 276 
MET H    H N N 277 
MET H2   H N N 278 
MET HA   H N N 279 
MET HB2  H N N 280 
MET HB3  H N N 281 
MET HG2  H N N 282 
MET HG3  H N N 283 
MET HE1  H N N 284 
MET HE2  H N N 285 
MET HE3  H N N 286 
MET HXT  H N N 287 
PHE N    N N N 288 
PHE CA   C N S 289 
PHE C    C N N 290 
PHE O    O N N 291 
PHE CB   C N N 292 
PHE CG   C Y N 293 
PHE CD1  C Y N 294 
PHE CD2  C Y N 295 
PHE CE1  C Y N 296 
PHE CE2  C Y N 297 
PHE CZ   C Y N 298 
PHE OXT  O N N 299 
PHE H    H N N 300 
PHE H2   H N N 301 
PHE HA   H N N 302 
PHE HB2  H N N 303 
PHE HB3  H N N 304 
PHE HD1  H N N 305 
PHE HD2  H N N 306 
PHE HE1  H N N 307 
PHE HE2  H N N 308 
PHE HZ   H N N 309 
PHE HXT  H N N 310 
PRO N    N N N 311 
PRO CA   C N S 312 
PRO C    C N N 313 
PRO O    O N N 314 
PRO CB   C N N 315 
PRO CG   C N N 316 
PRO CD   C N N 317 
PRO OXT  O N N 318 
PRO H    H N N 319 
PRO HA   H N N 320 
PRO HB2  H N N 321 
PRO HB3  H N N 322 
PRO HG2  H N N 323 
PRO HG3  H N N 324 
PRO HD2  H N N 325 
PRO HD3  H N N 326 
PRO HXT  H N N 327 
SER N    N N N 328 
SER CA   C N S 329 
SER C    C N N 330 
SER O    O N N 331 
SER CB   C N N 332 
SER OG   O N N 333 
SER OXT  O N N 334 
SER H    H N N 335 
SER H2   H N N 336 
SER HA   H N N 337 
SER HB2  H N N 338 
SER HB3  H N N 339 
SER HG   H N N 340 
SER HXT  H N N 341 
THR N    N N N 342 
THR CA   C N S 343 
THR C    C N N 344 
THR O    O N N 345 
THR CB   C N R 346 
THR OG1  O N N 347 
THR CG2  C N N 348 
THR OXT  O N N 349 
THR H    H N N 350 
THR H2   H N N 351 
THR HA   H N N 352 
THR HB   H N N 353 
THR HG1  H N N 354 
THR HG21 H N N 355 
THR HG22 H N N 356 
THR HG23 H N N 357 
THR HXT  H N N 358 
TRP N    N N N 359 
TRP CA   C N S 360 
TRP C    C N N 361 
TRP O    O N N 362 
TRP CB   C N N 363 
TRP CG   C Y N 364 
TRP CD1  C Y N 365 
TRP CD2  C Y N 366 
TRP NE1  N Y N 367 
TRP CE2  C Y N 368 
TRP CE3  C Y N 369 
TRP CZ2  C Y N 370 
TRP CZ3  C Y N 371 
TRP CH2  C Y N 372 
TRP OXT  O N N 373 
TRP H    H N N 374 
TRP H2   H N N 375 
TRP HA   H N N 376 
TRP HB2  H N N 377 
TRP HB3  H N N 378 
TRP HD1  H N N 379 
TRP HE1  H N N 380 
TRP HE3  H N N 381 
TRP HZ2  H N N 382 
TRP HZ3  H N N 383 
TRP HH2  H N N 384 
TRP HXT  H N N 385 
TYR N    N N N 386 
TYR CA   C N S 387 
TYR C    C N N 388 
TYR O    O N N 389 
TYR CB   C N N 390 
TYR CG   C Y N 391 
TYR CD1  C Y N 392 
TYR CD2  C Y N 393 
TYR CE1  C Y N 394 
TYR CE2  C Y N 395 
TYR CZ   C Y N 396 
TYR OH   O N N 397 
TYR OXT  O N N 398 
TYR H    H N N 399 
TYR H2   H N N 400 
TYR HA   H N N 401 
TYR HB2  H N N 402 
TYR HB3  H N N 403 
TYR HD1  H N N 404 
TYR HD2  H N N 405 
TYR HE1  H N N 406 
TYR HE2  H N N 407 
TYR HH   H N N 408 
TYR HXT  H N N 409 
VAL N    N N N 410 
VAL CA   C N S 411 
VAL C    C N N 412 
VAL O    O N N 413 
VAL CB   C N N 414 
VAL CG1  C N N 415 
VAL CG2  C N N 416 
VAL OXT  O N N 417 
VAL H    H N N 418 
VAL H2   H N N 419 
VAL HA   H N N 420 
VAL HB   H N N 421 
VAL HG11 H N N 422 
VAL HG12 H N N 423 
VAL HG13 H N N 424 
VAL HG21 H N N 425 
VAL HG22 H N N 426 
VAL HG23 H N N 427 
VAL HXT  H N N 428 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
D12 C1  C2   sing N N 83  
D12 C1  H11  sing N N 84  
D12 C1  H12  sing N N 85  
D12 C1  H13  sing N N 86  
D12 C2  C3   sing N N 87  
D12 C2  H21  sing N N 88  
D12 C2  H22  sing N N 89  
D12 C3  C4   sing N N 90  
D12 C3  H31  sing N N 91  
D12 C3  H32  sing N N 92  
D12 C4  C5   sing N N 93  
D12 C4  H41  sing N N 94  
D12 C4  H42  sing N N 95  
D12 C5  C6   sing N N 96  
D12 C5  H51  sing N N 97  
D12 C5  H52  sing N N 98  
D12 C6  C7   sing N N 99  
D12 C6  H61  sing N N 100 
D12 C6  H62  sing N N 101 
D12 C7  C8   sing N N 102 
D12 C7  H71  sing N N 103 
D12 C7  H72  sing N N 104 
D12 C8  C9   sing N N 105 
D12 C8  H81  sing N N 106 
D12 C8  H82  sing N N 107 
D12 C9  C10  sing N N 108 
D12 C9  H91  sing N N 109 
D12 C9  H92  sing N N 110 
D12 C10 C11  sing N N 111 
D12 C10 H101 sing N N 112 
D12 C10 H102 sing N N 113 
D12 C11 C12  sing N N 114 
D12 C11 H111 sing N N 115 
D12 C11 H112 sing N N 116 
D12 C12 H121 sing N N 117 
D12 C12 H122 sing N N 118 
D12 C12 H123 sing N N 119 
GLN N   CA   sing N N 120 
GLN N   H    sing N N 121 
GLN N   H2   sing N N 122 
GLN CA  C    sing N N 123 
GLN CA  CB   sing N N 124 
GLN CA  HA   sing N N 125 
GLN C   O    doub N N 126 
GLN C   OXT  sing N N 127 
GLN CB  CG   sing N N 128 
GLN CB  HB2  sing N N 129 
GLN CB  HB3  sing N N 130 
GLN CG  CD   sing N N 131 
GLN CG  HG2  sing N N 132 
GLN CG  HG3  sing N N 133 
GLN CD  OE1  doub N N 134 
GLN CD  NE2  sing N N 135 
GLN NE2 HE21 sing N N 136 
GLN NE2 HE22 sing N N 137 
GLN OXT HXT  sing N N 138 
GLU N   CA   sing N N 139 
GLU N   H    sing N N 140 
GLU N   H2   sing N N 141 
GLU CA  C    sing N N 142 
GLU CA  CB   sing N N 143 
GLU CA  HA   sing N N 144 
GLU C   O    doub N N 145 
GLU C   OXT  sing N N 146 
GLU CB  CG   sing N N 147 
GLU CB  HB2  sing N N 148 
GLU CB  HB3  sing N N 149 
GLU CG  CD   sing N N 150 
GLU CG  HG2  sing N N 151 
GLU CG  HG3  sing N N 152 
GLU CD  OE1  doub N N 153 
GLU CD  OE2  sing N N 154 
GLU OE2 HE2  sing N N 155 
GLU OXT HXT  sing N N 156 
GLY N   CA   sing N N 157 
GLY N   H    sing N N 158 
GLY N   H2   sing N N 159 
GLY CA  C    sing N N 160 
GLY CA  HA2  sing N N 161 
GLY CA  HA3  sing N N 162 
GLY C   O    doub N N 163 
GLY C   OXT  sing N N 164 
GLY OXT HXT  sing N N 165 
HIS N   CA   sing N N 166 
HIS N   H    sing N N 167 
HIS N   H2   sing N N 168 
HIS CA  C    sing N N 169 
HIS CA  CB   sing N N 170 
HIS CA  HA   sing N N 171 
HIS C   O    doub N N 172 
HIS C   OXT  sing N N 173 
HIS CB  CG   sing N N 174 
HIS CB  HB2  sing N N 175 
HIS CB  HB3  sing N N 176 
HIS CG  ND1  sing Y N 177 
HIS CG  CD2  doub Y N 178 
HIS ND1 CE1  doub Y N 179 
HIS ND1 HD1  sing N N 180 
HIS CD2 NE2  sing Y N 181 
HIS CD2 HD2  sing N N 182 
HIS CE1 NE2  sing Y N 183 
HIS CE1 HE1  sing N N 184 
HIS NE2 HE2  sing N N 185 
HIS OXT HXT  sing N N 186 
HOH O   H1   sing N N 187 
HOH O   H2   sing N N 188 
ILE N   CA   sing N N 189 
ILE N   H    sing N N 190 
ILE N   H2   sing N N 191 
ILE CA  C    sing N N 192 
ILE CA  CB   sing N N 193 
ILE CA  HA   sing N N 194 
ILE C   O    doub N N 195 
ILE C   OXT  sing N N 196 
ILE CB  CG1  sing N N 197 
ILE CB  CG2  sing N N 198 
ILE CB  HB   sing N N 199 
ILE CG1 CD1  sing N N 200 
ILE CG1 HG12 sing N N 201 
ILE CG1 HG13 sing N N 202 
ILE CG2 HG21 sing N N 203 
ILE CG2 HG22 sing N N 204 
ILE CG2 HG23 sing N N 205 
ILE CD1 HD11 sing N N 206 
ILE CD1 HD12 sing N N 207 
ILE CD1 HD13 sing N N 208 
ILE OXT HXT  sing N N 209 
LEU N   CA   sing N N 210 
LEU N   H    sing N N 211 
LEU N   H2   sing N N 212 
LEU CA  C    sing N N 213 
LEU CA  CB   sing N N 214 
LEU CA  HA   sing N N 215 
LEU C   O    doub N N 216 
LEU C   OXT  sing N N 217 
LEU CB  CG   sing N N 218 
LEU CB  HB2  sing N N 219 
LEU CB  HB3  sing N N 220 
LEU CG  CD1  sing N N 221 
LEU CG  CD2  sing N N 222 
LEU CG  HG   sing N N 223 
LEU CD1 HD11 sing N N 224 
LEU CD1 HD12 sing N N 225 
LEU CD1 HD13 sing N N 226 
LEU CD2 HD21 sing N N 227 
LEU CD2 HD22 sing N N 228 
LEU CD2 HD23 sing N N 229 
LEU OXT HXT  sing N N 230 
LYS N   CA   sing N N 231 
LYS N   H    sing N N 232 
LYS N   H2   sing N N 233 
LYS CA  C    sing N N 234 
LYS CA  CB   sing N N 235 
LYS CA  HA   sing N N 236 
LYS C   O    doub N N 237 
LYS C   OXT  sing N N 238 
LYS CB  CG   sing N N 239 
LYS CB  HB2  sing N N 240 
LYS CB  HB3  sing N N 241 
LYS CG  CD   sing N N 242 
LYS CG  HG2  sing N N 243 
LYS CG  HG3  sing N N 244 
LYS CD  CE   sing N N 245 
LYS CD  HD2  sing N N 246 
LYS CD  HD3  sing N N 247 
LYS CE  NZ   sing N N 248 
LYS CE  HE2  sing N N 249 
LYS CE  HE3  sing N N 250 
LYS NZ  HZ1  sing N N 251 
LYS NZ  HZ2  sing N N 252 
LYS NZ  HZ3  sing N N 253 
LYS OXT HXT  sing N N 254 
MET N   CA   sing N N 255 
MET N   H    sing N N 256 
MET N   H2   sing N N 257 
MET CA  C    sing N N 258 
MET CA  CB   sing N N 259 
MET CA  HA   sing N N 260 
MET C   O    doub N N 261 
MET C   OXT  sing N N 262 
MET CB  CG   sing N N 263 
MET CB  HB2  sing N N 264 
MET CB  HB3  sing N N 265 
MET CG  SD   sing N N 266 
MET CG  HG2  sing N N 267 
MET CG  HG3  sing N N 268 
MET SD  CE   sing N N 269 
MET CE  HE1  sing N N 270 
MET CE  HE2  sing N N 271 
MET CE  HE3  sing N N 272 
MET OXT HXT  sing N N 273 
PHE N   CA   sing N N 274 
PHE N   H    sing N N 275 
PHE N   H2   sing N N 276 
PHE CA  C    sing N N 277 
PHE CA  CB   sing N N 278 
PHE CA  HA   sing N N 279 
PHE C   O    doub N N 280 
PHE C   OXT  sing N N 281 
PHE CB  CG   sing N N 282 
PHE CB  HB2  sing N N 283 
PHE CB  HB3  sing N N 284 
PHE CG  CD1  doub Y N 285 
PHE CG  CD2  sing Y N 286 
PHE CD1 CE1  sing Y N 287 
PHE CD1 HD1  sing N N 288 
PHE CD2 CE2  doub Y N 289 
PHE CD2 HD2  sing N N 290 
PHE CE1 CZ   doub Y N 291 
PHE CE1 HE1  sing N N 292 
PHE CE2 CZ   sing Y N 293 
PHE CE2 HE2  sing N N 294 
PHE CZ  HZ   sing N N 295 
PHE OXT HXT  sing N N 296 
PRO N   CA   sing N N 297 
PRO N   CD   sing N N 298 
PRO N   H    sing N N 299 
PRO CA  C    sing N N 300 
PRO CA  CB   sing N N 301 
PRO CA  HA   sing N N 302 
PRO C   O    doub N N 303 
PRO C   OXT  sing N N 304 
PRO CB  CG   sing N N 305 
PRO CB  HB2  sing N N 306 
PRO CB  HB3  sing N N 307 
PRO CG  CD   sing N N 308 
PRO CG  HG2  sing N N 309 
PRO CG  HG3  sing N N 310 
PRO CD  HD2  sing N N 311 
PRO CD  HD3  sing N N 312 
PRO OXT HXT  sing N N 313 
SER N   CA   sing N N 314 
SER N   H    sing N N 315 
SER N   H2   sing N N 316 
SER CA  C    sing N N 317 
SER CA  CB   sing N N 318 
SER CA  HA   sing N N 319 
SER C   O    doub N N 320 
SER C   OXT  sing N N 321 
SER CB  OG   sing N N 322 
SER CB  HB2  sing N N 323 
SER CB  HB3  sing N N 324 
SER OG  HG   sing N N 325 
SER OXT HXT  sing N N 326 
THR N   CA   sing N N 327 
THR N   H    sing N N 328 
THR N   H2   sing N N 329 
THR CA  C    sing N N 330 
THR CA  CB   sing N N 331 
THR CA  HA   sing N N 332 
THR C   O    doub N N 333 
THR C   OXT  sing N N 334 
THR CB  OG1  sing N N 335 
THR CB  CG2  sing N N 336 
THR CB  HB   sing N N 337 
THR OG1 HG1  sing N N 338 
THR CG2 HG21 sing N N 339 
THR CG2 HG22 sing N N 340 
THR CG2 HG23 sing N N 341 
THR OXT HXT  sing N N 342 
TRP N   CA   sing N N 343 
TRP N   H    sing N N 344 
TRP N   H2   sing N N 345 
TRP CA  C    sing N N 346 
TRP CA  CB   sing N N 347 
TRP CA  HA   sing N N 348 
TRP C   O    doub N N 349 
TRP C   OXT  sing N N 350 
TRP CB  CG   sing N N 351 
TRP CB  HB2  sing N N 352 
TRP CB  HB3  sing N N 353 
TRP CG  CD1  doub Y N 354 
TRP CG  CD2  sing Y N 355 
TRP CD1 NE1  sing Y N 356 
TRP CD1 HD1  sing N N 357 
TRP CD2 CE2  doub Y N 358 
TRP CD2 CE3  sing Y N 359 
TRP NE1 CE2  sing Y N 360 
TRP NE1 HE1  sing N N 361 
TRP CE2 CZ2  sing Y N 362 
TRP CE3 CZ3  doub Y N 363 
TRP CE3 HE3  sing N N 364 
TRP CZ2 CH2  doub Y N 365 
TRP CZ2 HZ2  sing N N 366 
TRP CZ3 CH2  sing Y N 367 
TRP CZ3 HZ3  sing N N 368 
TRP CH2 HH2  sing N N 369 
TRP OXT HXT  sing N N 370 
TYR N   CA   sing N N 371 
TYR N   H    sing N N 372 
TYR N   H2   sing N N 373 
TYR CA  C    sing N N 374 
TYR CA  CB   sing N N 375 
TYR CA  HA   sing N N 376 
TYR C   O    doub N N 377 
TYR C   OXT  sing N N 378 
TYR CB  CG   sing N N 379 
TYR CB  HB2  sing N N 380 
TYR CB  HB3  sing N N 381 
TYR CG  CD1  doub Y N 382 
TYR CG  CD2  sing Y N 383 
TYR CD1 CE1  sing Y N 384 
TYR CD1 HD1  sing N N 385 
TYR CD2 CE2  doub Y N 386 
TYR CD2 HD2  sing N N 387 
TYR CE1 CZ   doub Y N 388 
TYR CE1 HE1  sing N N 389 
TYR CE2 CZ   sing Y N 390 
TYR CE2 HE2  sing N N 391 
TYR CZ  OH   sing N N 392 
TYR OH  HH   sing N N 393 
TYR OXT HXT  sing N N 394 
VAL N   CA   sing N N 395 
VAL N   H    sing N N 396 
VAL N   H2   sing N N 397 
VAL CA  C    sing N N 398 
VAL CA  CB   sing N N 399 
VAL CA  HA   sing N N 400 
VAL C   O    doub N N 401 
VAL C   OXT  sing N N 402 
VAL CB  CG1  sing N N 403 
VAL CB  CG2  sing N N 404 
VAL CB  HB   sing N N 405 
VAL CG1 HG11 sing N N 406 
VAL CG1 HG12 sing N N 407 
VAL CG1 HG13 sing N N 408 
VAL CG2 HG21 sing N N 409 
VAL CG2 HG22 sing N N 410 
VAL CG2 HG23 sing N N 411 
VAL OXT HXT  sing N N 412 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1DSB 
_pdbx_initial_refinement_model.details          'PDB ENTRY 1DSB' 
# 
_atom_sites.entry_id                    1TI1 
_atom_sites.fract_transf_matrix[1][1]   0.017495 
_atom_sites.fract_transf_matrix[1][2]   0.010100 
_atom_sites.fract_transf_matrix[1][3]   -0.000001 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020201 
_atom_sites.fract_transf_matrix[2][3]   -0.000001 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009107 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_