data_1TIZ # _entry.id 1TIZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TIZ pdb_00001tiz 10.2210/pdb1tiz/pdb RCSB RCSB022669 ? ? WWPDB D_1000022669 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-10 2 'Structure model' 1 1 2008-02-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TIZ _pdbx_database_status.recvd_initial_deposition_date 2004-06-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 6209 . unspecified TargetDB GO.33909 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Song, J.' 1 'Zhao, Q.' 2 'Thao, S.' 3 'Frederick, R.O.' 4 'Markley, J.L.' 5 'Center for Eukaryotic Structural Genomics (CESG)' 6 # _citation.id primary _citation.title 'Letter to the Editor: Solution structure of a calmodulin-like calcium-binding domain from Arabidopsis thaliana' _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 30 _citation.page_first 451 _citation.page_last 456 _citation.year 2004 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15630565 _citation.pdbx_database_id_DOI 10.1007/s10858-004-5356-7 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, J.' 1 ? primary 'Zhao, Q.' 2 ? primary 'Thao, S.' 3 ? primary 'Frederick, R.O.' 4 ? primary 'Markley, J.L.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'calmodulin-related protein, putative' _entity.formula_weight 7741.602 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKML _entity_poly.pdbx_seq_one_letter_code_can SSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKML _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GO.33909 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 ALA n 1 4 LYS n 1 5 ARG n 1 6 VAL n 1 7 PHE n 1 8 GLU n 1 9 LYS n 1 10 PHE n 1 11 ASP n 1 12 LYS n 1 13 ASN n 1 14 LYS n 1 15 ASP n 1 16 GLY n 1 17 LYS n 1 18 LEU n 1 19 SER n 1 20 LEU n 1 21 ASP n 1 22 GLU n 1 23 PHE n 1 24 ARG n 1 25 GLU n 1 26 VAL n 1 27 ALA n 1 28 LEU n 1 29 ALA n 1 30 PHE n 1 31 SER n 1 32 PRO n 1 33 TYR n 1 34 PHE n 1 35 THR n 1 36 GLN n 1 37 GLU n 1 38 ASP n 1 39 ILE n 1 40 VAL n 1 41 LYS n 1 42 PHE n 1 43 PHE n 1 44 GLU n 1 45 GLU n 1 46 ILE n 1 47 ASP n 1 48 VAL n 1 49 ASP n 1 50 GLY n 1 51 ASN n 1 52 GLY n 1 53 GLU n 1 54 LEU n 1 55 ASN n 1 56 ALA n 1 57 ASP n 1 58 GLU n 1 59 PHE n 1 60 THR n 1 61 SER n 1 62 CYS n 1 63 ILE n 1 64 GLU n 1 65 LYS n 1 66 MET n 1 67 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 LEU 67 67 67 LEU LEU A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 67 ? O ? A LEU 67 O 2 2 Y 1 A LEU 67 ? O ? A LEU 67 O 3 3 Y 1 A LEU 67 ? O ? A LEU 67 O 4 4 Y 1 A LEU 67 ? O ? A LEU 67 O 5 5 Y 1 A LEU 67 ? O ? A LEU 67 O 6 6 Y 1 A LEU 67 ? O ? A LEU 67 O 7 7 Y 1 A LEU 67 ? O ? A LEU 67 O 8 8 Y 1 A LEU 67 ? O ? A LEU 67 O 9 9 Y 1 A LEU 67 ? O ? A LEU 67 O 10 10 Y 1 A LEU 67 ? O ? A LEU 67 O 11 11 Y 1 A LEU 67 ? O ? A LEU 67 O 12 12 Y 1 A LEU 67 ? O ? A LEU 67 O 13 13 Y 1 A LEU 67 ? O ? A LEU 67 O 14 14 Y 1 A LEU 67 ? O ? A LEU 67 O 15 15 Y 1 A LEU 67 ? O ? A LEU 67 O 16 16 Y 1 A LEU 67 ? O ? A LEU 67 O 17 17 Y 1 A LEU 67 ? O ? A LEU 67 O 18 18 Y 1 A LEU 67 ? O ? A LEU 67 O 19 19 Y 1 A LEU 67 ? O ? A LEU 67 O 20 20 Y 1 A LEU 67 ? O ? A LEU 67 O # _exptl.entry_id 1TIZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1TIZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TIZ _struct.title 'Solution Structure of a Calmodulin-Like Calcium-Binding Domain from Arabidopsis thaliana' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TIZ _struct_keywords.pdbx_keywords 'Calcium-Binding Protein' _struct_keywords.text ;helix-turn-helix, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, Calcium-Binding Protein ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALL2_ARATH _struct_ref.pdbx_db_accession Q9SRP5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKML _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TIZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9SRP5 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 67 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1TIZ _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9SRP5 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 2 ? ASP A 11 ? SER A 2 ASP A 11 1 ? 10 HELX_P HELX_P2 2 LEU A 20 ? PHE A 30 ? LEU A 20 PHE A 30 1 ? 11 HELX_P HELX_P3 3 THR A 35 ? ASP A 47 ? THR A 35 ASP A 47 1 ? 13 HELX_P HELX_P4 4 ASN A 55 ? LYS A 65 ? ASN A 55 LYS A 65 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 18 ? SER A 19 ? LEU A 18 SER A 19 A 2 GLU A 53 ? LEU A 54 ? GLU A 53 LEU A 54 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 18 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 18 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 54 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 54 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 18 ? ? H A LEU 54 ? ? 1.36 2 1 HD22 A ASN 13 ? ? O A LYS 17 ? ? 1.49 3 1 O A PHE 42 ? ? H A ILE 46 ? ? 1.50 4 1 O A ILE 63 ? ? H A MET 66 ? ? 1.53 5 1 O A PHE 43 ? ? H A ASP 47 ? ? 1.55 6 1 O A PHE 10 ? ? H A LYS 12 ? ? 1.59 7 1 O A PHE 10 ? ? N A LYS 12 ? ? 2.08 8 1 O A LEU 18 ? ? N A LEU 54 ? ? 2.19 9 1 O A GLU 8 ? ? OD1 A ASP 11 ? ? 2.19 10 2 O A LEU 18 ? ? H A LEU 54 ? ? 1.31 11 2 O A PHE 43 ? ? H A ASP 47 ? ? 1.51 12 2 O A ILE 63 ? ? H A MET 66 ? ? 1.56 13 2 O A PHE 42 ? ? H A ILE 46 ? ? 1.58 14 2 O A PHE 10 ? ? N A LYS 12 ? ? 2.10 15 2 O A LEU 18 ? ? N A LEU 54 ? ? 2.15 16 2 O A ILE 63 ? ? O A MET 66 ? ? 2.16 17 3 O A LEU 18 ? ? H A LEU 54 ? ? 1.31 18 3 O A PHE 43 ? ? H A ASP 47 ? ? 1.44 19 3 O A PHE 7 ? ? H A ASP 11 ? ? 1.48 20 3 O A ILE 63 ? ? H A MET 66 ? ? 1.51 21 3 O A PHE 42 ? ? H A ILE 46 ? ? 1.53 22 3 O A PHE 10 ? ? N A LYS 12 ? ? 2.11 23 3 O A LEU 18 ? ? N A LEU 54 ? ? 2.14 24 4 O A LEU 18 ? ? H A LEU 54 ? ? 1.31 25 4 O A ILE 63 ? ? H A LEU 67 ? ? 1.39 26 4 O A PHE 42 ? ? H A ILE 46 ? ? 1.46 27 4 O A PHE 43 ? ? H A ASP 47 ? ? 1.50 28 4 O A PHE 7 ? ? H A ASP 11 ? ? 1.53 29 4 OD1 A ASP 49 ? ? H A ASN 51 ? ? 1.55 30 4 O A PHE 10 ? ? N A LYS 12 ? ? 2.12 31 4 O A LEU 18 ? ? N A LEU 54 ? ? 2.13 32 5 O A LEU 18 ? ? H A LEU 54 ? ? 1.31 33 5 O A PHE 43 ? ? H A ASP 47 ? ? 1.50 34 5 O A ILE 63 ? ? H A MET 66 ? ? 1.51 35 5 O A PHE 7 ? ? H A ASP 11 ? ? 1.55 36 5 O A PHE 10 ? ? N A LYS 12 ? ? 2.12 37 5 O A LEU 18 ? ? N A LEU 54 ? ? 2.14 38 6 O A LEU 18 ? ? H A LEU 54 ? ? 1.33 39 6 O A PHE 43 ? ? H A ASP 47 ? ? 1.46 40 6 O A PHE 42 ? ? H A ILE 46 ? ? 1.55 41 6 OD1 A ASP 49 ? ? H A ASN 51 ? ? 1.56 42 6 HD22 A ASN 13 ? ? O A LYS 17 ? ? 1.60 43 6 O A PHE 10 ? ? N A LYS 12 ? ? 2.08 44 6 O A LEU 18 ? ? N A LEU 54 ? ? 2.16 45 7 O A LEU 18 ? ? H A LEU 54 ? ? 1.33 46 7 O A PHE 43 ? ? H A ASP 47 ? ? 1.49 47 7 O A PHE 10 ? ? H A LYS 12 ? ? 1.53 48 7 H A THR 35 ? ? OD2 A ASP 38 ? ? 1.57 49 7 O A PHE 42 ? ? H A ILE 46 ? ? 1.57 50 7 O A ILE 63 ? ? H A MET 66 ? ? 1.58 51 7 O A PHE 10 ? ? N A LYS 12 ? ? 1.97 52 7 O A LEU 18 ? ? N A LEU 54 ? ? 2.16 53 7 O A ILE 63 ? ? O A MET 66 ? ? 2.17 54 8 O A LEU 18 ? ? H A LEU 54 ? ? 1.34 55 8 O A PHE 42 ? ? H A ILE 46 ? ? 1.49 56 8 O A ILE 63 ? ? H A MET 66 ? ? 1.49 57 8 O A PHE 43 ? ? H A ASP 47 ? ? 1.51 58 8 O A PHE 7 ? ? H A ASP 11 ? ? 1.58 59 8 O A PHE 10 ? ? N A LYS 12 ? ? 2.09 60 8 O A LEU 18 ? ? N A LEU 54 ? ? 2.17 61 8 O A GLU 8 ? ? OD1 A ASP 11 ? ? 2.19 62 9 O A LEU 18 ? ? H A LEU 54 ? ? 1.34 63 9 O A PHE 43 ? ? H A ASP 47 ? ? 1.44 64 9 O A ILE 63 ? ? H A MET 66 ? ? 1.55 65 9 OD1 A ASP 49 ? ? H A ASN 51 ? ? 1.56 66 9 O A PHE 42 ? ? H A ILE 46 ? ? 1.59 67 9 O A PHE 10 ? ? N A LYS 12 ? ? 2.10 68 9 O A LEU 18 ? ? N A LEU 54 ? ? 2.17 69 10 O A LEU 18 ? ? H A LEU 54 ? ? 1.31 70 10 O A PHE 43 ? ? H A ASP 47 ? ? 1.51 71 10 O A ILE 63 ? ? H A MET 66 ? ? 1.53 72 10 O A PHE 42 ? ? H A ILE 46 ? ? 1.54 73 10 O A PHE 7 ? ? H A ASP 11 ? ? 1.55 74 10 HD22 A ASN 13 ? ? O A LYS 17 ? ? 1.58 75 10 O A PHE 10 ? ? N A LYS 12 ? ? 2.09 76 10 O A LEU 18 ? ? N A LEU 54 ? ? 2.14 77 11 O A LEU 18 ? ? H A LEU 54 ? ? 1.33 78 11 O A PHE 43 ? ? H A ASP 47 ? ? 1.45 79 11 O A LEU 18 ? ? N A LEU 54 ? ? 2.15 80 11 O A PHE 10 ? ? N A LYS 12 ? ? 2.16 81 12 O A LEU 18 ? ? H A LEU 54 ? ? 1.27 82 12 O A PHE 42 ? ? H A ILE 46 ? ? 1.45 83 12 O A PHE 10 ? ? H A LYS 12 ? ? 1.51 84 12 O A PHE 43 ? ? H A ASP 47 ? ? 1.55 85 12 O A PHE 10 ? ? N A LYS 12 ? ? 1.95 86 12 O A LEU 18 ? ? N A LEU 54 ? ? 2.12 87 13 O A LEU 18 ? ? H A LEU 54 ? ? 1.33 88 13 O A PHE 43 ? ? H A ASP 47 ? ? 1.45 89 13 O A ILE 63 ? ? H A MET 66 ? ? 1.55 90 13 O A PHE 7 ? ? H A ASP 11 ? ? 1.57 91 13 O A PHE 42 ? ? H A ILE 46 ? ? 1.60 92 13 O A PHE 10 ? ? N A LYS 12 ? ? 2.12 93 13 O A GLU 8 ? ? OD2 A ASP 11 ? ? 2.12 94 13 O A LEU 18 ? ? N A LEU 54 ? ? 2.15 95 14 O A LEU 18 ? ? H A LEU 54 ? ? 1.33 96 14 O A PHE 43 ? ? H A ASP 47 ? ? 1.47 97 14 O A PHE 42 ? ? H A ILE 46 ? ? 1.51 98 14 O A PHE 7 ? ? H A ASP 11 ? ? 1.53 99 14 OD1 A ASP 49 ? ? H A ASN 51 ? ? 1.55 100 14 O A ILE 63 ? ? H A MET 66 ? ? 1.57 101 14 O A PHE 10 ? ? N A LYS 12 ? ? 2.13 102 14 O A LEU 18 ? ? N A LEU 54 ? ? 2.15 103 15 O A LEU 18 ? ? H A LEU 54 ? ? 1.29 104 15 O A PHE 42 ? ? H A ILE 46 ? ? 1.47 105 15 O A ILE 63 ? ? H A MET 66 ? ? 1.51 106 15 OD1 A ASP 49 ? ? H A ASN 51 ? ? 1.56 107 15 O A PHE 10 ? ? H A LYS 12 ? ? 1.58 108 15 O A PHE 10 ? ? N A LYS 12 ? ? 2.02 109 15 O A LEU 18 ? ? N A LEU 54 ? ? 2.14 110 16 O A LEU 18 ? ? H A LEU 54 ? ? 1.31 111 16 O A GLU 64 ? ? H A MET 66 ? ? 1.32 112 16 O A PHE 43 ? ? H A ASP 47 ? ? 1.42 113 16 O A PHE 42 ? ? H A ILE 46 ? ? 1.55 114 16 O A PHE 7 ? ? H A ASP 11 ? ? 1.56 115 16 O A GLU 64 ? ? N A MET 66 ? ? 2.00 116 16 O A LEU 18 ? ? N A LEU 54 ? ? 2.15 117 16 O A PHE 10 ? ? N A LYS 12 ? ? 2.15 118 17 O A LEU 18 ? ? H A LEU 54 ? ? 1.29 119 17 O A PHE 43 ? ? H A ASP 47 ? ? 1.55 120 17 O A PHE 10 ? ? N A LYS 12 ? ? 2.08 121 17 O A LEU 18 ? ? N A LEU 54 ? ? 2.13 122 18 O A LEU 18 ? ? H A LEU 54 ? ? 1.17 123 18 O A PHE 7 ? ? H A ASP 11 ? ? 1.45 124 18 O A ILE 63 ? ? H A MET 66 ? ? 1.46 125 18 O A PHE 43 ? ? H A ASP 47 ? ? 1.48 126 18 O A PHE 42 ? ? H A ILE 46 ? ? 1.58 127 18 O A LEU 18 ? ? N A LEU 54 ? ? 2.03 128 18 O A PHE 10 ? ? N A LYS 12 ? ? 2.09 129 19 O A LEU 18 ? ? H A LEU 54 ? ? 1.34 130 19 O A PHE 42 ? ? H A ILE 46 ? ? 1.46 131 19 O A PHE 43 ? ? H A ASP 47 ? ? 1.48 132 19 O A PHE 10 ? ? H A LYS 12 ? ? 1.52 133 19 O A PHE 10 ? ? N A LYS 12 ? ? 2.00 134 19 O A LEU 18 ? ? N A LEU 54 ? ? 2.17 135 20 O A LEU 18 ? ? H A LEU 54 ? ? 1.27 136 20 O A PHE 42 ? ? H A ILE 46 ? ? 1.42 137 20 O A PHE 43 ? ? H A ASP 47 ? ? 1.45 138 20 O A PHE 10 ? ? H A LYS 12 ? ? 1.56 139 20 O A ILE 63 ? ? H A MET 66 ? ? 1.59 140 20 O A PHE 10 ? ? N A LYS 12 ? ? 2.06 141 20 O A LEU 18 ? ? N A LEU 54 ? ? 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -77.73 26.35 2 1 ASP A 11 ? ? -51.13 77.71 3 1 LYS A 14 ? ? 25.70 51.28 4 1 SER A 31 ? ? -113.21 70.15 5 1 ASP A 47 ? ? -64.81 82.06 6 1 LYS A 65 ? ? -49.92 -12.86 7 2 SER A 2 ? ? -169.22 23.73 8 2 ASP A 11 ? ? -51.85 78.47 9 2 LYS A 14 ? ? 26.24 48.84 10 2 SER A 31 ? ? -110.31 73.79 11 2 ASP A 47 ? ? -67.84 77.56 12 2 LYS A 65 ? ? -56.19 -6.74 13 3 ASP A 11 ? ? -50.76 80.32 14 3 LYS A 14 ? ? 26.15 49.88 15 3 SER A 31 ? ? -111.34 70.13 16 3 ASP A 47 ? ? -67.12 76.83 17 3 LYS A 65 ? ? -49.25 -13.61 18 4 ASP A 11 ? ? -54.21 79.92 19 4 LYS A 14 ? ? 26.84 51.14 20 4 SER A 31 ? ? -110.71 70.88 21 4 ASP A 47 ? ? -65.11 80.82 22 5 SER A 2 ? ? 52.73 14.72 23 5 ASP A 11 ? ? -53.49 80.42 24 5 LYS A 14 ? ? 26.08 49.57 25 5 SER A 31 ? ? -114.28 69.86 26 5 ASP A 47 ? ? -68.01 79.44 27 5 LYS A 65 ? ? -53.86 -9.99 28 6 ASP A 11 ? ? -49.21 77.30 29 6 LYS A 14 ? ? 26.92 51.02 30 6 ASP A 47 ? ? -66.19 80.41 31 6 LYS A 65 ? ? -47.59 -14.29 32 6 MET A 66 ? ? -162.54 -167.67 33 7 ASP A 11 ? ? -47.44 76.96 34 7 LYS A 14 ? ? 25.93 49.76 35 7 SER A 31 ? ? -112.63 71.38 36 7 ASP A 47 ? ? -67.08 79.20 37 7 LYS A 65 ? ? -55.39 -7.25 38 8 SER A 2 ? ? 48.87 15.89 39 8 ASP A 11 ? ? -50.30 78.11 40 8 LYS A 14 ? ? 26.84 52.02 41 8 SER A 31 ? ? -116.19 69.80 42 8 PRO A 32 ? ? -49.61 -19.99 43 8 ASP A 47 ? ? -66.29 81.18 44 8 LYS A 65 ? ? -48.08 -15.41 45 8 MET A 66 ? ? -162.54 -166.12 46 9 SER A 2 ? ? -74.65 32.85 47 9 ASP A 11 ? ? -50.95 77.36 48 9 LYS A 14 ? ? 25.16 50.22 49 9 SER A 31 ? ? -112.19 69.05 50 9 ASP A 47 ? ? -66.57 78.62 51 9 LYS A 65 ? ? -48.32 -13.16 52 10 SER A 2 ? ? -174.04 25.88 53 10 ASP A 11 ? ? -49.43 77.63 54 10 LYS A 14 ? ? 26.67 50.22 55 10 SER A 31 ? ? -113.21 68.77 56 10 ASP A 47 ? ? -68.32 77.84 57 11 SER A 2 ? ? -73.88 28.67 58 11 ASP A 11 ? ? -56.51 79.96 59 11 LYS A 14 ? ? 26.10 49.22 60 11 SER A 31 ? ? -114.72 68.07 61 11 ASP A 47 ? ? -69.64 78.88 62 11 LYS A 65 ? ? -54.58 0.00 63 11 MET A 66 ? ? 165.30 17.04 64 12 SER A 2 ? ? 49.39 27.08 65 12 ASP A 11 ? ? -45.24 74.80 66 12 LYS A 14 ? ? 25.82 49.05 67 12 SER A 31 ? ? -118.29 69.41 68 12 PRO A 32 ? ? -49.18 -18.72 69 12 ASP A 47 ? ? -65.32 80.25 70 12 LYS A 65 ? ? -49.11 -12.86 71 13 SER A 2 ? ? -77.93 35.08 72 13 ASP A 11 ? ? -54.00 80.57 73 13 LYS A 14 ? ? 26.41 49.87 74 13 ASP A 47 ? ? -66.73 78.41 75 14 SER A 2 ? ? -89.36 49.69 76 14 ASP A 11 ? ? -54.14 80.64 77 14 LYS A 14 ? ? 27.20 49.89 78 14 SER A 31 ? ? -111.78 70.75 79 14 ASP A 47 ? ? -67.70 78.69 80 14 LYS A 65 ? ? -49.10 -11.89 81 15 SER A 2 ? ? -171.54 15.23 82 15 ASP A 11 ? ? -46.73 76.51 83 15 LYS A 14 ? ? 25.70 49.51 84 15 SER A 31 ? ? -113.24 66.89 85 15 ASP A 47 ? ? -64.90 80.56 86 15 LYS A 65 ? ? -49.18 -13.12 87 16 ASP A 11 ? ? -50.56 82.87 88 16 LYS A 14 ? ? 25.95 48.84 89 16 SER A 31 ? ? -108.50 73.23 90 16 ASP A 47 ? ? -67.57 78.33 91 16 LYS A 65 ? ? -46.59 13.76 92 16 MET A 66 ? ? 86.51 35.03 93 17 ASP A 11 ? ? -48.84 77.45 94 17 LYS A 14 ? ? 25.46 48.97 95 17 SER A 31 ? ? -113.62 68.61 96 17 LYS A 65 ? ? -59.76 -6.32 97 17 MET A 66 ? ? -160.44 0.77 98 18 SER A 2 ? ? -72.68 27.54 99 18 ASP A 11 ? ? -52.01 78.80 100 18 LYS A 14 ? ? 30.77 52.42 101 18 SER A 31 ? ? -112.73 69.35 102 18 ASP A 47 ? ? -67.43 79.12 103 19 SER A 2 ? ? -71.05 37.78 104 19 ASP A 11 ? ? -49.73 77.28 105 19 LYS A 14 ? ? 25.73 51.04 106 19 SER A 31 ? ? -110.96 72.40 107 19 ASP A 47 ? ? -66.00 80.26 108 19 LYS A 65 ? ? -48.60 -13.09 109 19 MET A 66 ? ? -162.52 -167.98 110 20 ASP A 11 ? ? -49.84 76.01 111 20 LYS A 14 ? ? 26.46 50.43 112 20 ASP A 47 ? ? -66.08 78.88 113 20 LYS A 65 ? ? -48.96 -13.34 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Center for Eukaryotic Structural Genomics' _pdbx_SG_project.initial_of_center CESG # _pdbx_nmr_ensemble.entry_id 1TIZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1TIZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5 mM DTT, 20 mM Bis-Tris, 5mM Ca2+, 1mM DSS, 0.02% NaN3, 1 mM protein' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.2 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1TIZ _pdbx_nmr_details.text 'This structure was determined using standard 3D techniques.' # _pdbx_nmr_refine.entry_id 1TIZ _pdbx_nmr_refine.method ;simulated annealing molecular dynamics torsion angle dynamics ; _pdbx_nmr_refine.details 'The structure was first calculated using torsion angle dynamics, and later refined using simulated annealing and molecular dynamics' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.2 collection ? 1 NMRPipe 2.1 processing ? 2 Sparky 3.72 'data analysis' ? 3 CYANA 1.0.5 'structure solution' ? 4 XPLOR-NIH 2.0.6 refinement ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TYR N N N N 297 TYR CA C N S 298 TYR C C N N 299 TYR O O N N 300 TYR CB C N N 301 TYR CG C Y N 302 TYR CD1 C Y N 303 TYR CD2 C Y N 304 TYR CE1 C Y N 305 TYR CE2 C Y N 306 TYR CZ C Y N 307 TYR OH O N N 308 TYR OXT O N N 309 TYR H H N N 310 TYR H2 H N N 311 TYR HA H N N 312 TYR HB2 H N N 313 TYR HB3 H N N 314 TYR HD1 H N N 315 TYR HD2 H N N 316 TYR HE1 H N N 317 TYR HE2 H N N 318 TYR HH H N N 319 TYR HXT H N N 320 VAL N N N N 321 VAL CA C N S 322 VAL C C N N 323 VAL O O N N 324 VAL CB C N N 325 VAL CG1 C N N 326 VAL CG2 C N N 327 VAL OXT O N N 328 VAL H H N N 329 VAL H2 H N N 330 VAL HA H N N 331 VAL HB H N N 332 VAL HG11 H N N 333 VAL HG12 H N N 334 VAL HG13 H N N 335 VAL HG21 H N N 336 VAL HG22 H N N 337 VAL HG23 H N N 338 VAL HXT H N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Bruker DMX 500 # _atom_sites.entry_id 1TIZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_