data_1TMR # _entry.id 1TMR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1TMR WWPDB D_1000176736 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TMR _pdbx_database_status.recvd_initial_deposition_date 1994-05-20 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Adler, M.' 1 'Seto, M.' 2 'Nitecki, D.' 3 'Light, D.R.' 4 'Morser, J.' 5 # _citation.id primary _citation.title 'The structure of a 19-residue fragment from the C-loop of the fourth epidermal growth factor-like domain of thrombomodulin.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 270 _citation.page_first 23366 _citation.page_last 23372 _citation.year 1995 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7559494 _citation.pdbx_database_id_DOI 10.1074/jbc.270.40.23366 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Adler, M.' 1 primary 'Seto, M.H.' 2 primary 'Nitecki, D.E.' 3 primary 'Lin, J.H.' 4 primary 'Light, D.R.' 5 primary 'Morser, J.' 6 # _cell.entry_id 1TMR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TMR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'THROMBOMODULIN PRECURSOR' _entity.formula_weight 2073.396 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VCAEGFAPIPGEPHRCQLF _entity_poly.pdbx_seq_one_letter_code_can VCAEGFAPIPGEPHRCQLF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 CYS n 1 3 ALA n 1 4 GLU n 1 5 GLY n 1 6 PHE n 1 7 ALA n 1 8 PRO n 1 9 ILE n 1 10 PRO n 1 11 GLY n 1 12 GLU n 1 13 PRO n 1 14 HIS n 1 15 ARG n 1 16 CYS n 1 17 GLN n 1 18 LEU n 1 19 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRBM_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07204 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGG VGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEV KADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQ HRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHE PHRCQMFCNQTACPADCDPNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLRKKQGAARAKMEYKCAAPSKE VVLQHVRTERTPQRL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TMR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 19 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07204 _struct_ref_seq.db_align_beg 389 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 407 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 19 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1TMR GLY A 11 ? UNP P07204 HIS 399 CONFLICT 11 1 1 1TMR LEU A 18 ? UNP P07204 MET 406 CONFLICT 18 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1TMR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name DGII _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BIOSYM,INC. _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1TMR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1TMR _struct.title 'THE STRUCTURE OF A 19 RESIDUE FRAGMENT FROM THE C-LOOP OF THE FOURTH EPIDERMAL GROWTH FACTOR-LIKE DOMAIN OF THROMBOMODULIN' _struct.pdbx_descriptor ;THROMBOMODULIN (C-LOOP FOURTH EGF-LIKE DOMAIN) MUTANT WITH HIS 11 REPLACED BY GLY, MET 18 REPLACED BY LEU (H11G, M18L) (NMR, 10 STRUCTURES) ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TMR _struct_keywords.pdbx_keywords 'BLOOD COAGULATION' _struct_keywords.text 'BLOOD COAGULATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 2 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 16 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 2 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 16 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.064 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1TMR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TMR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-06-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.360 1.252 0.108 0.011 N 2 1 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.364 1.252 0.112 0.011 N 3 2 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.361 1.252 0.109 0.011 N 4 2 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.364 1.252 0.112 0.011 N 5 3 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.360 1.252 0.108 0.011 N 6 3 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.364 1.252 0.112 0.011 N 7 4 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.359 1.252 0.107 0.011 N 8 4 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.363 1.252 0.111 0.011 N 9 4 CG A HIS 14 ? ? CD2 A HIS 14 ? ? 1.409 1.354 0.055 0.009 N 10 5 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.360 1.252 0.108 0.011 N 11 5 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.365 1.252 0.113 0.011 N 12 6 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.359 1.252 0.107 0.011 N 13 6 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.364 1.252 0.112 0.011 N 14 7 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.360 1.252 0.108 0.011 N 15 7 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.363 1.252 0.111 0.011 N 16 8 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.360 1.252 0.108 0.011 N 17 8 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.363 1.252 0.111 0.011 N 18 9 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.359 1.252 0.107 0.011 N 19 9 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.365 1.252 0.113 0.011 N 20 10 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.362 1.252 0.110 0.011 N 21 10 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.364 1.252 0.112 0.011 N 22 10 CG A HIS 14 ? ? CD2 A HIS 14 ? ? 1.409 1.354 0.055 0.009 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.90 111.50 8.40 1.30 N 2 1 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.84 120.30 4.54 0.50 N 3 2 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.89 111.50 8.39 1.30 N 4 2 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.87 120.30 4.57 0.50 N 5 3 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.92 111.50 8.42 1.30 N 6 3 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.83 120.30 4.53 0.50 N 7 4 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.97 111.50 8.47 1.30 N 8 4 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.81 120.30 4.51 0.50 N 9 5 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.94 111.50 8.44 1.30 N 10 5 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.84 120.30 4.54 0.50 N 11 6 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 120.00 111.50 8.50 1.30 N 12 6 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.86 120.30 4.56 0.50 N 13 7 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.96 111.50 8.46 1.30 N 14 7 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.87 120.30 4.57 0.50 N 15 8 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.93 111.50 8.43 1.30 N 16 8 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.92 120.30 4.62 0.50 N 17 9 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.99 111.50 8.49 1.30 N 18 9 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.86 120.30 4.56 0.50 N 19 10 ND1 A HIS 14 ? ? CE1 A HIS 14 ? ? NE2 A HIS 14 ? ? 119.93 111.50 8.43 1.30 N 20 10 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 124.86 120.30 4.56 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 2 ? ? -166.55 -124.51 2 1 ALA A 7 ? ? 174.22 165.84 3 1 PRO A 8 ? ? -54.85 176.76 4 1 PRO A 10 ? ? -63.33 98.64 5 1 PRO A 13 ? ? -87.58 37.30 6 1 CYS A 16 ? ? -102.36 -160.66 7 1 GLN A 17 ? ? -168.53 -134.26 8 2 CYS A 2 ? ? -165.58 -97.59 9 2 GLU A 4 ? ? -68.50 94.39 10 2 PRO A 8 ? ? -56.74 178.41 11 2 PRO A 13 ? ? -79.96 31.84 12 2 ARG A 15 ? ? -120.75 -168.15 13 2 GLN A 17 ? ? -159.44 -135.36 14 3 CYS A 2 ? ? -93.31 -86.87 15 3 PRO A 8 ? ? -63.52 -160.18 16 3 PRO A 13 ? ? -87.51 43.97 17 3 GLN A 17 ? ? -178.21 -132.50 18 4 CYS A 2 ? ? 69.82 -94.31 19 4 PRO A 8 ? ? -60.60 -175.91 20 4 PRO A 13 ? ? -82.35 30.03 21 4 GLN A 17 ? ? -132.83 -146.75 22 5 CYS A 2 ? ? 78.79 -89.71 23 5 ALA A 3 ? ? 169.49 147.67 24 5 PRO A 8 ? ? -57.07 178.13 25 5 PRO A 13 ? ? -80.25 31.70 26 5 GLN A 17 ? ? -141.41 -146.23 27 6 CYS A 2 ? ? 50.65 -98.51 28 6 ALA A 3 ? ? 169.04 158.48 29 6 PRO A 13 ? ? -84.69 39.08 30 6 CYS A 16 ? ? -103.45 -169.43 31 6 GLN A 17 ? ? -175.04 -125.12 32 7 CYS A 2 ? ? -169.29 -96.92 33 7 GLU A 4 ? ? -69.04 89.91 34 7 PRO A 8 ? ? -55.41 176.74 35 7 PRO A 13 ? ? -84.81 37.38 36 7 GLN A 17 ? ? -82.77 -141.61 37 8 CYS A 2 ? ? -159.79 -85.76 38 8 PRO A 8 ? ? -55.72 173.99 39 8 PRO A 13 ? ? -77.89 29.80 40 8 GLN A 17 ? ? -112.40 -122.72 41 9 CYS A 2 ? ? 43.71 -108.85 42 9 ALA A 3 ? ? 168.41 132.22 43 9 GLU A 4 ? ? -55.16 93.06 44 9 PRO A 8 ? ? -62.89 -173.74 45 9 PRO A 13 ? ? -87.48 39.63 46 9 CYS A 16 ? ? -88.96 -157.67 47 9 GLN A 17 ? ? -171.44 -57.97 48 10 CYS A 2 ? ? 52.33 -94.48 49 10 PRO A 8 ? ? -61.64 -178.12 50 10 PRO A 13 ? ? -85.88 37.06 51 10 GLN A 17 ? ? -147.86 -52.55 #