data_1TNS # _entry.id 1TNS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TNS pdb_00001tns 10.2210/pdb1tns/pdb WWPDB D_1000176761 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1TNT _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TNS _pdbx_database_status.recvd_initial_deposition_date 1994-10-10 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Clubb, R.T.' 2 'Omichinski, J.G.' 3 'Gronenborn, A.M.' 4 # _citation.id primary _citation.title 'A novel class of winged helix-turn-helix protein: the DNA-binding domain of Mu transposase.' _citation.journal_abbrev Structure _citation.journal_volume 2 _citation.page_first 1041 _citation.page_last 1048 _citation.year 1994 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7881904 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(94)00107-3' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clubb, R.T.' 1 ? primary 'Omichinski, J.G.' 2 ? primary 'Savilahti, H.' 3 ? primary 'Mizuuchi, K.' 4 ? primary 'Gronenborn, A.M.' 5 ? primary 'Clore, G.M.' 6 ? # _cell.entry_id 1TNS _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TNS _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description MU-TRANSPOSASE _entity.formula_weight 8268.502 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MELWVSPKELANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFE _entity_poly.pdbx_seq_one_letter_code_can MELWVSPKELANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LEU n 1 4 TRP n 1 5 VAL n 1 6 SER n 1 7 PRO n 1 8 LYS n 1 9 GLU n 1 10 LEU n 1 11 ALA n 1 12 ASN n 1 13 LEU n 1 14 PRO n 1 15 GLY n 1 16 LEU n 1 17 PRO n 1 18 LYS n 1 19 THR n 1 20 SER n 1 21 ALA n 1 22 GLY n 1 23 VAL n 1 24 ILE n 1 25 TYR n 1 26 VAL n 1 27 ALA n 1 28 LYS n 1 29 LYS n 1 30 GLN n 1 31 GLY n 1 32 TRP n 1 33 GLN n 1 34 ASN n 1 35 ARG n 1 36 THR n 1 37 ARG n 1 38 ALA n 1 39 GLY n 1 40 VAL n 1 41 LYS n 1 42 GLY n 1 43 GLY n 1 44 LYS n 1 45 ALA n 1 46 ILE n 1 47 GLU n 1 48 TYR n 1 49 ASN n 1 50 ALA n 1 51 ASN n 1 52 SER n 1 53 LEU n 1 54 PRO n 1 55 VAL n 1 56 GLU n 1 57 ALA n 1 58 LYS n 1 59 ALA n 1 60 ALA n 1 61 LEU n 1 62 LEU n 1 63 LEU n 1 64 ARG n 1 65 GLN n 1 66 GLY n 1 67 GLU n 1 68 ILE n 1 69 GLU n 1 70 THR n 1 71 SER n 1 72 LEU n 1 73 GLY n 1 74 TYR n 1 75 PHE n 1 76 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'Mu-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage Mu' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10677 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRA_BPMU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07636 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MELWVSPKECANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFEIARP TLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDW AAALVDGRGASRRNVHKSEFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGWSIPSRATAFRRIQQLDEAMVVACR EGEHALMHLIPAQQRTVEHLDAMQWINGDGYLHNVFVRWFNGDVIRPKTWFWQDVKTRKILGWRCDVSENIDSIRLSFMD VVTRYGIPEDFHITIDNTRGAANKWLTGGAPNRYRFKVKEDDPKGLFLLMGAKMHWTSVVAGKGWGQAKPVERAFGVGGL EEYVDKHPALAGAYTGPNPQAKPDNYGDRAVDAELFLKTLAEGVAMFNARTGRETEMCGGKLSFDDVFEREYARTIVRKP TEEQKRMLLLPAEAVNVSRKGEFTLKVGGSLKGAKNVYYNMALMNAGVKKVVVRFDPQQLHSTVYCYTLDGRFICEAECL APVAFNDAAAGREYRRRQKQLKSATKAAIKAQKQMDALEVAELLPQIAEPAAPESRIVGIFRPSGNTERVKNQERDDEYE TERDEYLNHSLDILEQNRRKKAI ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TNS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07636 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1TNS _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 10 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P07636 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 10 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 10 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_refine.entry_id 1TNS _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;THE 3D SOLUTION STRUCTURE OF THE DNA BINDING DOMAIN OF MU TRANSPOSASE (MUA76, RESIDUES 1 - 76) WAS SOLVED BY MULTIDIMENSIONAL HETERONUCLEAR-EDITED NMR EXPERIMENTS AND IS BASED ON 1320 EXPERIMENTAL RESTRAINTS COMPRISING THE FOLLOWING: (A) 1192 APPROXIMATE INTERPROTON DISTANCE RESTRAINTS (308 SEQUENTIAL, 266 SHORT RANGE 1 , |I-J| <=5, 323 LONG RANGE |I-J|>5, AND 295 INTRARESIDUE (B) 18 DISTANCE RESTRAINTS FOR 9 BACKBONE HYDROGEN BONDS (C) 36 HN-CAH COUPLING CONSTANT RESTRAINTS (D) 74 TORSION ANGLE RESTRAINTS (40 PHI, 23 CHI1 AND 11 CHI2). A COMPLETE LIST OF EXPERIMENTAL RESTRAINTS HAVE BEEN DEPOSITED WITH THE BROOKHAVEN DATA BANK. THE STRUCTURES ARE CALCULATED USING THE HYBRID METRIC MATRIX DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD DESCRIBED BY: NILGES, M., CLORE, G.M. & GRONENBORN, A.M. (1988) FEBS LETT 229, 317 - 324 ALL STRUCTURAL STATISTICS ARE GIVEN IN REF. 1. THIS STRUCTURE IS THE RESTRAINED MINIMIZED AVERAGE STRUCTURE: (SA)R. THIS IS OBTAINED BY FIRST AVERAGING THE COORDINATES OF THE INDIVIDUAL 33 DYNAMICAL SIMULATED ANNEALING (SA) STRUCTURES BEST FITTED TO RESIDUES 3 - 36 AND 45 - 65 AND SUBJECTING THE RESULTING COORDINATES TO RESTRAINED MINIMIZATION. THE LAST NUMBER COLUMN IN THIS SET OF COORDINATES (THE B-FACTOR COLUMN IN X-RAY STRUCTURES) GIVES THE AVERAGE RMS DIFFERENCE BETWEEN THE INDIVIDUAL SA STRUCTURES AND THE MEAN STRUCTURE. THE NUMBERS IN THE LAST COLUMN OF THE INDIVIDUAL STRUCTURES HAVE NO MEANING. RESIDUES 1 - 2, 66 - 76, AND 37 - 44 ARE DISORDERED IN SOLUTION. THE 33 INDIVIDUAL STRUCTURES CAN BE FOUND IN PDB ENTRY 1TNT. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1TNS _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1TNS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1TNS _struct.title 'A NOVEL CLASS OF WINGED HELIX-TURN-HELIX PROTEIN: THE DNA-BINDING DOMAIN OF MU TRANSPOSASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TNS _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-BINDING PROTEIN, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? ALA A 11 ? SER A 6 ALA A 11 1 ? 6 HELX_P HELX_P2 2 THR A 19 ? LYS A 29 ? THR A 19 LYS A 29 1 ? 11 HELX_P HELX_P3 3 PRO A 54 ? GLN A 65 ? PRO A 54 GLN A 65 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 4 ? VAL A 5 ? TRP A 4 VAL A 5 A 2 TYR A 48 ? ASN A 49 ? TYR A 48 ASN A 49 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 5 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 5 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 48 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 48 # _database_PDB_matrix.entry_id 1TNS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TNS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLU 76 76 76 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-02-14 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_keywords 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_keywords.text' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 3 ? ? -161.65 74.35 2 1 ALA A 11 ? ? -64.14 29.24 3 1 ASN A 12 ? ? -146.05 -8.49 4 1 PRO A 17 ? ? -55.06 177.69 5 1 GLN A 30 ? ? -150.16 -61.74 6 1 GLN A 33 ? ? -47.88 98.07 7 1 VAL A 40 ? ? -93.08 -83.13 8 1 LYS A 41 ? ? -80.52 -74.06 9 1 LYS A 44 ? ? 52.05 97.32 10 1 PRO A 54 ? ? -57.25 -165.06 11 1 GLU A 67 ? ? 55.99 93.37 12 1 ILE A 68 ? ? -85.14 -77.92 13 1 GLU A 69 ? ? -136.18 -133.64 14 1 THR A 70 ? ? -80.73 -139.27 15 1 SER A 71 ? ? 73.33 -74.16 16 1 PHE A 75 ? ? 40.84 23.60 #