data_1TTX # _entry.id 1TTX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TTX pdb_00001ttx 10.2210/pdb1ttx/pdb RCSB RCSB022897 ? ? WWPDB D_1000022897 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-18 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2016-12-28 5 'Structure model' 1 4 2021-11-10 6 'Structure model' 1 5 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_nmr_software 3 5 'Structure model' pdbx_nmr_spectrometer 4 5 'Structure model' pdbx_struct_conn_angle 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.value' 18 5 'Structure model' '_struct_conn.pdbx_dist_value' 19 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 5 'Structure model' '_struct_ref_seq_dif.details' 32 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TTX _pdbx_database_status.recvd_initial_deposition_date 2004-06-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id CIRMMP08 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Babini, E.' 1 'Bertini, I.' 2 'Capozzi, F.' 3 'Del Bianco, C.' 4 'Hollender, D.' 5 'Kiss, T.' 6 'Luchinat, C.' 7 'Quattrone, A.' 8 'Structural Proteomics in Europe (SPINE)' 9 # _citation.id primary _citation.title ;Solution Structure of Human beta-Parvalbumin and Structural Comparison with Its Paralog alpha-Parvalbumin and with Their Rat Orthologs(,) ; _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 16076 _citation.page_last 16085 _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15610002 _citation.pdbx_database_id_DOI 10.1021/bi048388o # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Babini, E.' 1 ? primary 'Bertini, I.' 2 ? primary 'Capozzi, F.' 3 ? primary 'Del Bianco, C.' 4 ? primary 'Hollender, D.' 5 ? primary 'Kiss, T.' 6 ? primary 'Luchinat, C.' 7 ? primary 'Quattrone, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Oncomodulin 12195.325 1 ? Q20R ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'beta parvalbumin, OM' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTE SETKSLMAAADNDGDGKIGAEEFQEMVHS ; _entity_poly.pdbx_seq_one_letter_code_can ;MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTE SETKSLMAAADNDGDGKIGAEEFQEMVHS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CIRMMP08 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ILE n 1 4 THR n 1 5 ASP n 1 6 VAL n 1 7 LEU n 1 8 SER n 1 9 ALA n 1 10 ASP n 1 11 ASP n 1 12 ILE n 1 13 ALA n 1 14 ALA n 1 15 ALA n 1 16 LEU n 1 17 GLN n 1 18 GLU n 1 19 CYS n 1 20 ARG n 1 21 ASP n 1 22 PRO n 1 23 ASP n 1 24 THR n 1 25 PHE n 1 26 GLU n 1 27 PRO n 1 28 GLN n 1 29 LYS n 1 30 PHE n 1 31 PHE n 1 32 GLN n 1 33 THR n 1 34 SER n 1 35 GLY n 1 36 LEU n 1 37 SER n 1 38 LYS n 1 39 MET n 1 40 SER n 1 41 ALA n 1 42 ASN n 1 43 GLN n 1 44 VAL n 1 45 LYS n 1 46 ASP n 1 47 VAL n 1 48 PHE n 1 49 ARG n 1 50 PHE n 1 51 ILE n 1 52 ASP n 1 53 ASN n 1 54 ASP n 1 55 GLN n 1 56 SER n 1 57 GLY n 1 58 TYR n 1 59 LEU n 1 60 ASP n 1 61 GLU n 1 62 GLU n 1 63 GLU n 1 64 LEU n 1 65 LYS n 1 66 PHE n 1 67 PHE n 1 68 LEU n 1 69 GLN n 1 70 LYS n 1 71 PHE n 1 72 GLU n 1 73 SER n 1 74 GLY n 1 75 ALA n 1 76 ARG n 1 77 GLU n 1 78 LEU n 1 79 THR n 1 80 GLU n 1 81 SER n 1 82 GLU n 1 83 THR n 1 84 LYS n 1 85 SER n 1 86 LEU n 1 87 MET n 1 88 ALA n 1 89 ALA n 1 90 ALA n 1 91 ASP n 1 92 ASN n 1 93 ASP n 1 94 GLY n 1 95 ASP n 1 96 GLY n 1 97 LYS n 1 98 ILE n 1 99 GLY n 1 100 ALA n 1 101 GLU n 1 102 GLU n 1 103 PHE n 1 104 GLN n 1 105 GLU n 1 106 MET n 1 107 VAL n 1 108 HIS n 1 109 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'Homo sapiens' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Xl1Blue cells' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE30Xa _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 SER 109 109 109 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 110 110 CA CA A . C 2 CA 1 111 111 CA CA A . # _exptl.entry_id 1TTX _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _database_PDB_matrix.entry_id 1TTX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TTX _struct.title 'Solution Structure of human beta parvalbumin (oncomodulin) refined with a paramagnetism based strategy' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TTX _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'oncomodulin, EF-hand, lanthanide, Structural Genomics, Structural Proteomics in Europe, SPINE, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ONCO_HUMAN _struct_ref.pdbx_db_accession P32930 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTE SETKSLMAAADNDGDGKIGAEEFQEMVHS ; _struct_ref.pdbx_align_begin 0 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TTX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32930 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1TTX _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 20 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P32930 _struct_ref_seq_dif.db_mon_id GLN _struct_ref_seq_dif.pdbx_seq_db_seq_num 19 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 20 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 7 ? CYS A 19 ? LEU A 7 CYS A 19 1 ? 13 HELX_P HELX_P2 2 GLU A 26 ? SER A 34 ? GLU A 26 SER A 34 1 ? 9 HELX_P HELX_P3 3 SER A 40 ? ASP A 52 ? SER A 40 ASP A 52 1 ? 13 HELX_P HELX_P4 4 ASP A 60 ? LYS A 65 ? ASP A 60 LYS A 65 1 ? 6 HELX_P HELX_P5 5 PHE A 66 ? PHE A 71 ? PHE A 66 PHE A 71 5 ? 6 HELX_P HELX_P6 6 THR A 79 ? ASP A 91 ? THR A 79 ASP A 91 1 ? 13 HELX_P HELX_P7 7 GLY A 99 ? SER A 109 ? GLY A 99 SER A 109 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 52 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 52 A CA 111 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc2 metalc ? ? A ASP 52 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 52 A CA 111 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc3 metalc ? ? A SER 56 OG ? ? ? 1_555 C CA . CA ? ? A SER 56 A CA 111 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc4 metalc ? ? A TYR 58 O ? ? ? 1_555 C CA . CA ? ? A TYR 58 A CA 111 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc5 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 63 A CA 111 1_555 ? ? ? ? ? ? ? 2.215 ? ? metalc6 metalc ? ? A GLU 63 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 63 A CA 111 1_555 ? ? ? ? ? ? ? 2.277 ? ? metalc7 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 91 A CA 110 1_555 ? ? ? ? ? ? ? 2.213 ? ? metalc8 metalc ? ? A ASP 93 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 93 A CA 110 1_555 ? ? ? ? ? ? ? 4.391 ? ? metalc9 metalc ? ? A ASP 93 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 93 A CA 110 1_555 ? ? ? ? ? ? ? 2.198 ? ? metalc10 metalc ? ? A ASP 95 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 95 A CA 110 1_555 ? ? ? ? ? ? ? 3.482 ? ? metalc11 metalc ? ? A ASP 95 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 95 A CA 110 1_555 ? ? ? ? ? ? ? 2.232 ? ? metalc12 metalc ? ? A LYS 97 O ? ? ? 1_555 B CA . CA ? ? A LYS 97 A CA 110 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc13 metalc ? ? A GLU 102 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 102 A CA 110 1_555 ? ? ? ? ? ? ? 2.264 ? ? metalc14 metalc ? ? A GLU 102 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 102 A CA 110 1_555 ? ? ? ? ? ? ? 2.368 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OD2 ? A ASP 52 ? A ASP 52 ? 1_555 54.9 ? 2 OD1 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OG ? A SER 56 ? A SER 56 ? 1_555 108.4 ? 3 OD2 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OG ? A SER 56 ? A SER 56 ? 1_555 108.7 ? 4 OD1 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 O ? A TYR 58 ? A TYR 58 ? 1_555 122.0 ? 5 OD2 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 O ? A TYR 58 ? A TYR 58 ? 1_555 76.4 ? 6 OG ? A SER 56 ? A SER 56 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 O ? A TYR 58 ? A TYR 58 ? 1_555 116.2 ? 7 OD1 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 100.0 ? 8 OD2 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 123.0 ? 9 OG ? A SER 56 ? A SER 56 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 128.3 ? 10 O ? A TYR 58 ? A TYR 58 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 80.3 ? 11 OD1 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 112.7 ? 12 OD2 ? A ASP 52 ? A ASP 52 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 167.5 ? 13 OG ? A SER 56 ? A SER 56 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 72.3 ? 14 O ? A TYR 58 ? A TYR 58 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 114.8 ? 15 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? C CA . ? A CA 111 ? 1_555 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 56.9 ? 16 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 126.4 ? 17 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 133.9 ? 18 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 7.5 ? 19 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 110.7 ? 20 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 73.8 ? 21 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 72.5 ? 22 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 74.4 ? 23 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 88.4 ? 24 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 91.4 ? 25 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 37.4 ? 26 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 O ? A LYS 97 ? A LYS 97 ? 1_555 86.4 ? 27 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 O ? A LYS 97 ? A LYS 97 ? 1_555 142.4 ? 28 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 O ? A LYS 97 ? A LYS 97 ? 1_555 136.2 ? 29 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 O ? A LYS 97 ? A LYS 97 ? 1_555 77.7 ? 30 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 O ? A LYS 97 ? A LYS 97 ? 1_555 83.4 ? 31 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 90.0 ? 32 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 86.4 ? 33 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 86.3 ? 34 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 157.2 ? 35 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 155.9 ? 36 O ? A LYS 97 ? A LYS 97 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 114.4 ? 37 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 125.6 ? 38 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 94.6 ? 39 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 88.5 ? 40 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 114.5 ? 41 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 149.0 ? 42 O ? A LYS 97 ? A LYS 97 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 75.5 ? 43 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 CA ? B CA . ? A CA 110 ? 1_555 OE2 ? A GLU 102 ? A GLU 102 ? 1_555 55.0 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 110 ? 5 'BINDING SITE FOR RESIDUE CA A 110' AC2 Software A CA 111 ? 4 'BINDING SITE FOR RESIDUE CA A 111' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 91 ? ASP A 91 . ? 1_555 ? 2 AC1 5 ASP A 93 ? ASP A 93 . ? 1_555 ? 3 AC1 5 ASP A 95 ? ASP A 95 . ? 1_555 ? 4 AC1 5 LYS A 97 ? LYS A 97 . ? 1_555 ? 5 AC1 5 GLU A 102 ? GLU A 102 . ? 1_555 ? 6 AC2 4 ASP A 52 ? ASP A 52 . ? 1_555 ? 7 AC2 4 SER A 56 ? SER A 56 . ? 1_555 ? 8 AC2 4 TYR A 58 ? TYR A 58 . ? 1_555 ? 9 AC2 4 GLU A 63 ? GLU A 63 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 5 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.40 120.30 3.10 0.50 N 2 15 CB A ASP 52 ? ? CG A ASP 52 ? ? OD2 A ASP 52 ? ? 123.77 118.30 5.47 0.90 N 3 15 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH2 A ARG 76 ? ? 116.60 120.30 -3.70 0.50 N 4 19 CB A ASP 52 ? ? CG A ASP 52 ? ? OD2 A ASP 52 ? ? 124.35 118.30 6.05 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -161.95 -66.92 2 1 LEU A 7 ? ? 173.24 -58.80 3 1 CYS A 19 ? ? -106.92 62.55 4 1 ASP A 23 ? ? 74.40 37.62 5 1 GLN A 55 ? ? 59.64 12.64 6 1 TYR A 58 ? ? -171.05 143.71 7 1 LEU A 59 ? ? -102.93 68.54 8 1 ASN A 92 ? ? -76.26 41.31 9 1 ASP A 93 ? ? -126.11 -58.98 10 2 SER A 2 ? ? -161.95 -66.92 11 2 LEU A 7 ? ? 173.24 -58.80 12 2 CYS A 19 ? ? -106.92 62.55 13 2 ASP A 23 ? ? 74.40 37.62 14 2 GLN A 55 ? ? 59.64 12.64 15 2 TYR A 58 ? ? -171.05 143.71 16 2 LEU A 59 ? ? -102.93 68.54 17 2 ASN A 92 ? ? -76.26 41.31 18 2 ASP A 93 ? ? -126.11 -58.98 19 3 ASP A 5 ? ? -153.11 44.34 20 3 VAL A 6 ? ? -128.29 -59.14 21 3 LEU A 7 ? ? -172.54 -47.55 22 3 PRO A 27 ? ? -65.70 -73.34 23 3 GLN A 55 ? ? 53.87 72.09 24 3 PHE A 67 ? ? -66.06 -74.63 25 3 PHE A 71 ? ? -94.07 -62.70 26 3 ALA A 75 ? ? -91.10 -142.41 27 3 ASN A 92 ? ? -76.19 45.48 28 3 ASP A 93 ? ? -135.37 -58.93 29 3 ASP A 95 ? ? -124.60 -61.89 30 4 SER A 2 ? ? 157.74 -72.24 31 4 VAL A 6 ? ? -121.02 -61.82 32 4 LEU A 7 ? ? -171.95 -61.55 33 4 SER A 8 ? ? -33.03 -37.83 34 4 SER A 40 ? ? 113.99 139.93 35 4 ASP A 52 ? ? -155.99 -49.04 36 4 ASN A 53 ? ? 97.62 -52.88 37 4 ALA A 75 ? ? -71.42 -165.85 38 4 GLU A 77 ? ? -59.35 -6.90 39 4 ASP A 95 ? ? -121.94 -55.03 40 5 ASP A 5 ? ? -174.64 -50.89 41 5 LEU A 7 ? ? -164.34 -58.47 42 5 ASP A 52 ? ? -66.98 75.57 43 5 ASP A 54 ? ? 72.23 -44.77 44 5 SER A 56 ? ? -57.78 -6.98 45 5 PHE A 66 ? ? -152.80 30.28 46 5 GLN A 69 ? ? -69.50 14.06 47 5 ASP A 95 ? ? -134.74 -50.63 48 6 SER A 2 ? ? 143.90 -82.17 49 6 VAL A 6 ? ? -120.05 -64.40 50 6 LEU A 7 ? ? -169.89 -54.45 51 6 SER A 8 ? ? -34.70 -29.61 52 6 CYS A 19 ? ? -108.29 52.62 53 6 PRO A 27 ? ? -67.19 -82.21 54 6 ASP A 52 ? ? 73.67 -51.05 55 6 ASN A 53 ? ? 77.51 -42.09 56 6 GLN A 55 ? ? 91.88 -1.88 57 6 LEU A 59 ? ? -68.87 87.93 58 6 PHE A 67 ? ? -50.92 -70.45 59 6 PHE A 71 ? ? -90.62 -61.86 60 6 ALA A 75 ? ? -74.90 -134.51 61 7 SER A 2 ? ? -174.08 -56.47 62 7 ASP A 5 ? ? -80.99 45.33 63 7 VAL A 6 ? ? -143.46 -57.59 64 7 LEU A 7 ? ? -166.25 -56.11 65 7 CYS A 19 ? ? -86.40 46.88 66 7 PRO A 27 ? ? -69.36 -71.80 67 7 LEU A 59 ? ? -104.01 70.30 68 7 PHE A 67 ? ? -79.21 -75.84 69 7 PHE A 71 ? ? -100.96 -60.13 70 7 SER A 73 ? ? 74.97 -50.70 71 7 ASN A 92 ? ? -77.46 49.88 72 7 ASP A 93 ? ? -137.53 -60.44 73 7 ASP A 95 ? ? -121.85 -61.53 74 8 SER A 2 ? ? -136.05 -88.86 75 8 ASP A 5 ? ? -168.38 45.84 76 8 VAL A 6 ? ? -148.13 -50.83 77 8 LEU A 7 ? ? 177.98 -56.10 78 8 CYS A 19 ? ? -105.94 46.91 79 8 ASP A 23 ? ? 69.27 -0.15 80 8 SER A 40 ? ? 135.34 143.97 81 8 ASP A 52 ? ? -69.91 70.02 82 8 PHE A 67 ? ? -52.20 -70.99 83 8 ALA A 75 ? ? -89.17 -98.82 84 8 ARG A 76 ? ? -144.07 24.53 85 8 ASN A 92 ? ? 46.31 25.61 86 9 VAL A 6 ? ? -125.34 -56.33 87 9 LEU A 7 ? ? -171.55 -59.20 88 9 CYS A 19 ? ? -85.49 41.58 89 9 ASP A 52 ? ? 75.55 -55.80 90 9 ASN A 53 ? ? 96.52 -54.41 91 9 LYS A 70 ? ? -77.78 42.31 92 9 PHE A 71 ? ? -147.04 -56.87 93 9 SER A 73 ? ? 81.40 109.13 94 9 ALA A 75 ? ? -85.88 -154.77 95 9 ASN A 92 ? ? -77.07 41.58 96 9 ASP A 93 ? ? -128.14 -59.72 97 9 ASP A 95 ? ? -125.10 -63.89 98 10 SER A 2 ? ? -173.26 48.68 99 10 ILE A 3 ? ? 69.41 -48.35 100 10 THR A 4 ? ? -38.77 -29.94 101 10 ASP A 5 ? ? -145.22 57.25 102 10 LEU A 7 ? ? -169.67 -60.55 103 10 PRO A 27 ? ? -68.40 -78.42 104 10 ASP A 54 ? ? 75.91 -33.82 105 11 SER A 2 ? ? -156.77 -91.25 106 11 VAL A 6 ? ? -135.72 -52.67 107 11 LEU A 7 ? ? 179.85 -60.80 108 11 SER A 8 ? ? -49.94 -17.50 109 11 CYS A 19 ? ? -111.02 55.81 110 11 ASP A 23 ? ? 69.52 -22.66 111 11 THR A 24 ? ? -73.88 24.37 112 11 SER A 40 ? ? 117.27 147.22 113 11 LEU A 59 ? ? -118.23 76.61 114 11 PHE A 66 ? ? -150.91 68.88 115 11 ALA A 75 ? ? -76.67 -150.27 116 11 ASN A 92 ? ? -82.20 39.80 117 11 ASP A 93 ? ? -127.98 -58.23 118 11 ASP A 95 ? ? -127.54 -51.90 119 12 ASP A 5 ? ? -86.02 46.41 120 12 VAL A 6 ? ? -142.01 -58.96 121 12 LEU A 7 ? ? -171.41 -51.82 122 12 CYS A 19 ? ? -104.83 67.16 123 12 PHE A 66 ? ? -149.11 32.77 124 12 PHE A 67 ? ? -64.77 -72.22 125 12 SER A 73 ? ? 104.30 117.68 126 12 ASP A 95 ? ? -128.29 -64.78 127 13 ASP A 5 ? ? -98.18 42.25 128 13 VAL A 6 ? ? -136.73 -59.95 129 13 LEU A 7 ? ? -170.87 -47.24 130 13 CYS A 19 ? ? -112.52 58.86 131 13 PRO A 27 ? ? -65.67 -71.64 132 13 ASP A 52 ? ? -66.40 76.36 133 13 GLN A 55 ? ? 101.54 10.76 134 13 PHE A 66 ? ? -151.17 27.78 135 13 ASP A 95 ? ? -121.36 -63.21 136 13 LYS A 97 ? ? -58.29 101.11 137 14 ASP A 5 ? ? 174.42 -48.92 138 14 LEU A 7 ? ? -175.71 -60.11 139 14 CYS A 19 ? ? -92.36 38.22 140 14 ASP A 23 ? ? 55.68 19.35 141 14 PRO A 27 ? ? -66.42 -70.61 142 14 ASN A 53 ? ? 79.14 -56.09 143 14 GLN A 55 ? ? 83.95 24.09 144 14 LEU A 59 ? ? -109.19 70.19 145 14 PHE A 67 ? ? -85.77 -76.88 146 14 LYS A 70 ? ? -83.79 48.01 147 14 PHE A 71 ? ? -153.12 -58.21 148 14 SER A 73 ? ? 78.81 107.80 149 14 ALA A 75 ? ? -79.11 -146.90 150 14 GLU A 77 ? ? -31.02 -33.19 151 14 ASP A 93 ? ? -163.29 -46.26 152 15 SER A 2 ? ? 149.23 -86.05 153 15 VAL A 6 ? ? -145.38 -48.71 154 15 LEU A 7 ? ? -178.78 -48.83 155 15 CYS A 19 ? ? -116.83 69.05 156 15 ASP A 23 ? ? 82.83 4.14 157 15 ARG A 76 ? ? -173.52 -47.73 158 15 GLU A 77 ? ? -39.71 -31.31 159 15 ASP A 93 ? ? -137.01 -61.63 160 15 ASP A 95 ? ? -127.18 -57.69 161 16 ASP A 5 ? ? -174.65 -56.51 162 16 LEU A 7 ? ? -164.62 -55.10 163 16 PHE A 66 ? ? -148.26 44.01 164 16 SER A 73 ? ? 82.62 109.12 165 16 ALA A 75 ? ? -85.92 -156.39 166 17 SER A 2 ? ? -147.04 -67.85 167 17 LEU A 7 ? ? -175.66 -58.14 168 17 CYS A 19 ? ? -101.81 46.54 169 17 ASP A 23 ? ? 56.85 15.93 170 17 PRO A 27 ? ? -62.71 -76.97 171 17 ASP A 52 ? ? -69.26 72.61 172 17 GLN A 55 ? ? 59.23 80.04 173 17 SER A 56 ? ? -118.08 -70.25 174 17 PHE A 67 ? ? -75.84 -79.12 175 17 ALA A 75 ? ? -59.17 171.32 176 17 GLU A 77 ? ? -28.15 -43.49 177 17 ASN A 92 ? ? -74.79 37.39 178 17 ASP A 93 ? ? -121.92 -55.48 179 17 ASP A 95 ? ? -122.05 -55.73 180 18 ASP A 5 ? ? -152.72 52.10 181 18 LEU A 7 ? ? -167.67 -55.92 182 18 ASP A 52 ? ? -64.12 74.62 183 18 ASP A 54 ? ? 76.22 -47.15 184 18 LYS A 65 ? ? -57.50 -5.96 185 18 PHE A 67 ? ? -53.99 -73.38 186 18 GLU A 72 ? ? -104.24 -123.52 187 18 SER A 73 ? ? -157.29 -5.64 188 18 ALA A 75 ? ? -89.02 -106.46 189 18 ARG A 76 ? ? -151.11 50.49 190 18 ASN A 92 ? ? 43.59 23.13 191 18 ASP A 95 ? ? -127.74 -54.81 192 19 SER A 2 ? ? -86.40 -143.93 193 19 VAL A 6 ? ? -90.60 -61.31 194 19 LEU A 7 ? ? -166.26 -60.32 195 19 CYS A 19 ? ? -109.15 55.83 196 19 PRO A 22 ? ? -51.16 -70.92 197 19 ASP A 23 ? ? -77.08 49.35 198 19 LYS A 65 ? ? -55.02 -8.15 199 19 PHE A 67 ? ? -42.48 -75.92 200 19 PHE A 71 ? ? -90.56 -65.02 201 19 ASN A 92 ? ? -80.41 35.40 202 19 ASP A 93 ? ? -142.92 -55.04 203 20 SER A 2 ? ? -142.98 -150.06 204 20 ASP A 5 ? ? -89.70 42.46 205 20 VAL A 6 ? ? -144.94 -63.96 206 20 LEU A 7 ? ? -166.52 -57.16 207 20 CYS A 19 ? ? -99.01 36.91 208 20 SER A 40 ? ? 93.19 147.79 209 20 ASP A 52 ? ? -65.61 79.31 210 20 PHE A 67 ? ? -91.84 -80.42 211 20 SER A 73 ? ? 107.63 113.52 212 20 ALA A 75 ? ? -85.47 -118.59 213 20 VAL A 107 ? ? -70.56 -76.02 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 50 ? ? 0.087 'SIDE CHAIN' 2 2 PHE A 50 ? ? 0.087 'SIDE CHAIN' 3 3 ARG A 20 ? ? 0.079 'SIDE CHAIN' 4 3 PHE A 71 ? ? 0.079 'SIDE CHAIN' 5 5 PHE A 25 ? ? 0.136 'SIDE CHAIN' 6 7 ARG A 76 ? ? 0.122 'SIDE CHAIN' 7 8 ARG A 76 ? ? 0.149 'SIDE CHAIN' 8 9 PHE A 48 ? ? 0.103 'SIDE CHAIN' 9 9 ARG A 76 ? ? 0.089 'SIDE CHAIN' 10 10 ARG A 76 ? ? 0.179 'SIDE CHAIN' 11 11 PHE A 25 ? ? 0.079 'SIDE CHAIN' 12 11 PHE A 48 ? ? 0.099 'SIDE CHAIN' 13 11 ARG A 76 ? ? 0.098 'SIDE CHAIN' 14 12 PHE A 48 ? ? 0.102 'SIDE CHAIN' 15 12 PHE A 71 ? ? 0.100 'SIDE CHAIN' 16 14 ARG A 76 ? ? 0.101 'SIDE CHAIN' 17 14 PHE A 103 ? ? 0.082 'SIDE CHAIN' 18 15 PHE A 25 ? ? 0.134 'SIDE CHAIN' 19 15 TYR A 58 ? ? 0.081 'SIDE CHAIN' 20 15 PHE A 67 ? ? 0.139 'SIDE CHAIN' 21 18 PHE A 48 ? ? 0.117 'SIDE CHAIN' 22 18 TYR A 58 ? ? 0.069 'SIDE CHAIN' 23 19 TYR A 58 ? ? 0.068 'SIDE CHAIN' 24 20 PHE A 71 ? ? 0.084 'SIDE CHAIN' 25 20 ARG A 76 ? ? 0.165 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Proteomics in Europe' _pdbx_SG_project.initial_of_center SPINE # _pdbx_nmr_ensemble.entry_id 1TTX _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1TTX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '4mM protein U-15N-13C; 100mM NaCl; pH 6.5' '90% H2O/10% D2O' 2 '4mM protein U-15N; 100mM NaCl; pH 6.5' '90% H2O/10% D2O' 3 '4mM protein unlabeled; 100mM NaCl; pH 6.5' '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 2 1 3D_15N-separated_NOESY 3 3 1 '2D NOESY' 4 2 1 HNHA # _pdbx_nmr_details.entry_id 1TTX _pdbx_nmr_details.text 'The structure was determined using diamagnetic constraints plus Pseudocontact Shifts and Residual Dipolar Coupling' # _pdbx_nmr_refine.entry_id 1TTX _pdbx_nmr_refine.method 'distance geometry simulated annealing torsion angle dynamics; pseudocontact shifts residual dipolar couplings;' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1 collection Brunger 1 XwinNMR 3.1 processing Brunger 2 Sparky 3 'data analysis' Goddard 3 DYANA 1.5 'structure solution' Guntert 4 Amber 5 refinement Pearlman 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TYR N N N N 319 TYR CA C N S 320 TYR C C N N 321 TYR O O N N 322 TYR CB C N N 323 TYR CG C Y N 324 TYR CD1 C Y N 325 TYR CD2 C Y N 326 TYR CE1 C Y N 327 TYR CE2 C Y N 328 TYR CZ C Y N 329 TYR OH O N N 330 TYR OXT O N N 331 TYR H H N N 332 TYR H2 H N N 333 TYR HA H N N 334 TYR HB2 H N N 335 TYR HB3 H N N 336 TYR HD1 H N N 337 TYR HD2 H N N 338 TYR HE1 H N N 339 TYR HE2 H N N 340 TYR HH H N N 341 TYR HXT H N N 342 VAL N N N N 343 VAL CA C N S 344 VAL C C N N 345 VAL O O N N 346 VAL CB C N N 347 VAL CG1 C N N 348 VAL CG2 C N N 349 VAL OXT O N N 350 VAL H H N N 351 VAL H2 H N N 352 VAL HA H N N 353 VAL HB H N N 354 VAL HG11 H N N 355 VAL HG12 H N N 356 VAL HG13 H N N 357 VAL HG21 H N N 358 VAL HG22 H N N 359 VAL HG23 H N N 360 VAL HXT H N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 700 2 ? Bruker AVANCE 600 # _atom_sites.entry_id 1TTX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ #