data_1TZ5
# 
_entry.id   1TZ5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.399 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1TZ5         pdb_00001tz5 10.2210/pdb1tz5/pdb 
RCSB  RCSB023044   ?            ?                   
WWPDB D_1000023044 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-05 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-01-01 
5 'Structure model' 1 4 2024-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Database references'       
5  4 'Structure model' 'Derived calculations'      
6  4 'Structure model' 'Source and taxonomy'       
7  4 'Structure model' 'Structure summary'         
8  5 'Structure model' 'Data collection'           
9  5 'Structure model' 'Database references'       
10 5 'Structure model' 'Derived calculations'      
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' entity                    
2  4 'Structure model' entity_name_com           
3  4 'Structure model' entity_src_gen            
4  4 'Structure model' pdbx_nmr_software         
5  4 'Structure model' pdbx_nmr_spectrometer     
6  4 'Structure model' pdbx_struct_assembly      
7  4 'Structure model' pdbx_struct_assembly_prop 
8  4 'Structure model' pdbx_struct_oper_list     
9  4 'Structure model' struct_conn               
10 4 'Structure model' struct_ref                
11 4 'Structure model' struct_ref_seq_dif        
12 5 'Structure model' chem_comp_atom            
13 5 'Structure model' chem_comp_bond            
14 5 'Structure model' database_2                
15 5 'Structure model' pdbx_entry_details        
16 5 'Structure model' pdbx_modification_feature 
17 5 'Structure model' struct_site               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_entity.pdbx_description'            
2  4 'Structure model' '_entity_name_com.name'               
3  4 'Structure model' '_pdbx_nmr_software.name'             
4  4 'Structure model' '_pdbx_nmr_spectrometer.model'        
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  4 'Structure model' '_struct_ref.db_code'                 
7  5 'Structure model' '_database_2.pdbx_DOI'                
8  5 'Structure model' '_database_2.pdbx_database_accession' 
9  5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
10 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
11 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TZ5 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1LJV 'bPP bound to DPC micelles'             unspecified 
PDB 1F8P 'pNPY bound to DPC micelles'            unspecified 
PDB 1TZ4 '[hPP19-23]-pNPY bound to DPC Micelles' unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lerch, M.'            1 
'Kamimori, H.'         2 
'Folkers, G.'          3 
'Aguilar, M.I.'        4 
'Beck-Sickinger, A.G.' 5 
'Zerbe, O.'            6 
# 
_citation.id                        primary 
_citation.title                     
;Strongly Altered Receptor Binding Properties in PP and NPY Chimeras Are Accompanied by Changes 
in Structure and Membrane Binding
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            44 
_citation.page_first                9255 
_citation.page_last                 9264 
_citation.year                      2005 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15966750 
_citation.pdbx_database_id_DOI      10.1021/bi0501232 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lerch, M.'            1 ? 
primary 'Kamimori, H.'         2 ? 
primary 'Folkers, G.'          3 ? 
primary 'Aguilar, M.I.'        4 ? 
primary 'Beck-Sickinger, A.G.' 5 ? 
primary 'Zerbe, O.'            6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Pancreatic prohormone,neuropeptide Y,Pancreatic prohormone' 
_entity.formula_weight             4277.887 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pancreatic polypeptide,PP,Pancreatic polypeptide,PP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'APLEPVYPGDNATPEQMARYYSALRRYINMLTRPRY(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   APLEPVYPGDNATPEQMARYYSALRRYINMLTRPRYX 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  PRO n 
1 3  LEU n 
1 4  GLU n 
1 5  PRO n 
1 6  VAL n 
1 7  TYR n 
1 8  PRO n 
1 9  GLY n 
1 10 ASP n 
1 11 ASN n 
1 12 ALA n 
1 13 THR n 
1 14 PRO n 
1 15 GLU n 
1 16 GLN n 
1 17 MET n 
1 18 ALA n 
1 19 ARG n 
1 20 TYR n 
1 21 TYR n 
1 22 SER n 
1 23 ALA n 
1 24 LEU n 
1 25 ARG n 
1 26 ARG n 
1 27 TYR n 
1 28 ILE n 
1 29 ASN n 
1 30 MET n 
1 31 LEU n 
1 32 THR n 
1 33 ARG n 
1 34 PRO n 
1 35 ARG n 
1 36 TYR n 
1 37 NH2 n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  18 Human 'Homo, Sus' 'PPY, PNP' , ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 
'PUBK19-[pNPY19-23]-hPP-G' ? ? 
1 2 sample 'Biological sequence' 19 23 Pig   'Homo, Sus' NPY        , ? ? ? ? ? 'Sus scrofa'   9823 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 
'PUBK19-[pNPY19-23]-hPP-G' ? ? 
1 3 sample 'Biological sequence' 24 37 Human 'Homo, Sus' 'PPY, PNP' , ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 
'PUBK19-[pNPY19-23]-hPP-G' ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  PRO 2  2  2  PRO PRO A . n 
A 1 3  LEU 3  3  3  LEU LEU A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  PRO 5  5  5  PRO PRO A . n 
A 1 6  VAL 6  6  6  VAL VAL A . n 
A 1 7  TYR 7  7  7  TYR TYR A . n 
A 1 8  PRO 8  8  8  PRO PRO A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 ASN 11 11 11 ASN ASN A . n 
A 1 12 ALA 12 12 12 ALA ALA A . n 
A 1 13 THR 13 13 13 THR THR A . n 
A 1 14 PRO 14 14 14 PRO PRO A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 GLN 16 16 16 GLN GLN A . n 
A 1 17 MET 17 17 17 MET MET A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 ARG 19 19 19 ARG ARG A . n 
A 1 20 TYR 20 20 20 TYR TYR A . n 
A 1 21 TYR 21 21 21 TYR TYR A . n 
A 1 22 SER 22 22 22 SER SER A . n 
A 1 23 ALA 23 23 23 ALA ALA A . n 
A 1 24 LEU 24 24 24 LEU LEU A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 TYR 27 27 27 TYR TYR A . n 
A 1 28 ILE 28 28 28 ILE ILE A . n 
A 1 29 ASN 29 29 29 ASN ASN A . n 
A 1 30 MET 30 30 30 MET MET A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 THR 32 32 32 THR THR A . n 
A 1 33 ARG 33 33 33 ARG ARG A . n 
A 1 34 PRO 34 34 34 PRO PRO A . n 
A 1 35 ARG 35 35 35 ARG ARG A . n 
A 1 36 TYR 36 36 36 TYR TYR A . n 
A 1 37 NH2 37 37 37 NH2 NH2 A . n 
# 
_exptl.entry_id          1TZ5 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1TZ5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1TZ5 
_struct.title                     '[pNPY19-23]-hPP bound to DPC Micelles' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TZ5 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            'NPY-PP Chimera, HORMONE-GROWTH FACTOR COMPLEX' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PAHO_HUMAN P01298 ? 1 APLEPVYPGDNATPEQMA 30 
2 UNP NPY_PIG    P01304 ? 1 RYYSA              28 
3 UNP PAHO_HUMAN P01298 ? 1 LRRYINMLTRPRY      53 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TZ5 A 1  ? 18 ? P01298 30 ? 47 ? 1  18 
2 2 1TZ5 A 19 ? 23 ? P01304 28 ? 32 ? 19 23 
3 3 1TZ5 A 24 ? 36 ? P01298 53 ? 65 ? 24 36 
# 
_struct_ref_seq_dif.align_id                     3 
_struct_ref_seq_dif.pdbx_pdb_id_code             1TZ5 
_struct_ref_seq_dif.mon_id                       NH2 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      37 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01298 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      amidation 
_struct_ref_seq_dif.pdbx_auth_seq_num            37 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 100  ? 
1 MORE         0    ? 
1 'SSA (A^2)'  4720 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       THR 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        13 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       THR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        32 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        THR 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         13 
_struct_conf.end_auth_comp_id        THR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         32 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        both 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           TYR 
_struct_conn.ptnr1_label_seq_id            36 
_struct_conn.ptnr1_label_atom_id           C 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           NH2 
_struct_conn.ptnr2_label_seq_id            37 
_struct_conn.ptnr2_label_atom_id           N 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            TYR 
_struct_conn.ptnr1_auth_seq_id             36 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            NH2 
_struct_conn.ptnr2_auth_seq_id             37 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.320 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      NH2 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       37 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     TYR 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      36 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       NH2 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        37 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      TYR 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       36 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               . 
_pdbx_modification_feature.modified_residue_id_linking_atom   . 
_pdbx_modification_feature.modified_residue_id                TYR 
_pdbx_modification_feature.ref_pcm_id                         5 
_pdbx_modification_feature.ref_comp_id                        NH2 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Terminal amidation' 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NH2 
_struct_site.pdbx_auth_seq_id     37 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE NH2 A 37' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        TYR 
_struct_site_gen.label_asym_id        A 
_struct_site_gen.label_seq_id         36 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         TYR 
_struct_site_gen.auth_asym_id         A 
_struct_site_gen.auth_seq_id          36 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_pdbx_entry_details.entry_id                   1TZ5 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 13 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.34 120.30 3.04 0.50 N 
2 18 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.43 120.30 3.13 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  LEU A 3  ? ? -168.12 92.68   
2  1  VAL A 6  ? ? 64.36   152.87  
3  1  TYR A 7  ? ? 58.92   78.99   
4  1  ASN A 11 ? ? 66.43   100.55  
5  2  VAL A 6  ? ? 64.70   156.63  
6  2  ASP A 10 ? ? 65.56   87.77   
7  2  ALA A 12 ? ? 60.16   90.64   
8  2  ARG A 35 ? ? -167.19 89.10   
9  3  GLU A 4  ? ? -46.09  151.54  
10 3  PRO A 5  ? ? -68.99  1.97    
11 3  VAL A 6  ? ? 58.69   12.65   
12 3  TYR A 7  ? ? -151.38 87.77   
13 3  ASP A 10 ? ? 62.12   175.77  
14 3  ASN A 11 ? ? -155.21 70.11   
15 3  THR A 13 ? ? -172.23 142.23  
16 3  ARG A 33 ? ? 63.12   146.72  
17 4  LEU A 3  ? ? -161.66 116.28  
18 4  TYR A 7  ? ? 51.28   77.37   
19 4  ASN A 11 ? ? -59.29  -78.26  
20 5  GLU A 4  ? ? 67.73   70.60   
21 5  PRO A 5  ? ? -69.36  -168.23 
22 5  VAL A 6  ? ? -46.30  154.99  
23 5  TYR A 7  ? ? 62.32   163.11  
24 5  ASP A 10 ? ? 63.19   177.78  
25 5  ALA A 12 ? ? 55.43   -169.92 
26 5  ARG A 35 ? ? -165.61 86.79   
27 6  TYR A 7  ? ? -27.06  91.79   
28 6  ASP A 10 ? ? 39.90   79.58   
29 6  ASN A 11 ? ? 57.26   77.58   
30 6  THR A 13 ? ? -52.89  103.72  
31 6  ARG A 35 ? ? -164.32 -39.71  
32 7  LEU A 3  ? ? 66.17   138.74  
33 7  VAL A 6  ? ? 64.14   152.58  
34 7  TYR A 7  ? ? 54.19   87.08   
35 7  ARG A 35 ? ? 161.01  -75.63  
36 8  PRO A 5  ? ? -69.53  -173.63 
37 8  TYR A 7  ? ? -153.05 86.90   
38 8  ASP A 10 ? ? 68.47   168.66  
39 8  THR A 13 ? ? 84.96   155.51  
40 8  THR A 32 ? ? -93.23  30.02   
41 8  ARG A 35 ? ? -163.64 87.46   
42 9  GLU A 15 ? ? 55.73   4.70    
43 9  ARG A 35 ? ? -173.52 84.48   
44 10 GLU A 4  ? ? 59.85   169.18  
45 10 ASN A 11 ? ? -172.06 73.09   
46 10 ALA A 12 ? ? 69.76   107.53  
47 10 ARG A 33 ? ? -175.99 -60.21  
48 10 ARG A 35 ? ? 165.22  -30.73  
49 11 ASN A 11 ? ? 65.98   119.19  
50 11 ALA A 12 ? ? -64.98  -170.40 
51 11 GLU A 15 ? ? 61.41   -8.52   
52 12 PRO A 2  ? ? -70.10  -79.05  
53 12 LEU A 3  ? ? -169.14 38.28   
54 12 VAL A 6  ? ? 47.36   -153.25 
55 12 ARG A 33 ? ? -167.59 -55.31  
56 12 ARG A 35 ? ? -174.28 -37.79  
57 13 ASP A 10 ? ? 64.63   87.53   
58 13 ARG A 35 ? ? 62.34   74.41   
59 14 LEU A 3  ? ? 60.97   115.85  
60 14 ASP A 10 ? ? 58.05   85.55   
61 14 ASN A 11 ? ? -164.02 86.78   
62 14 ARG A 33 ? ? 60.37   143.29  
63 15 TYR A 7  ? ? -163.86 83.40   
64 15 ASP A 10 ? ? 48.78   80.25   
65 15 ASN A 11 ? ? -76.26  -90.50  
66 16 GLU A 4  ? ? 173.34  -54.17  
67 16 TYR A 7  ? ? 54.88   83.36   
68 16 THR A 13 ? ? 52.60   140.79  
69 16 ARG A 35 ? ? 72.41   -7.08   
70 17 GLU A 4  ? ? 157.04  -62.85  
71 17 VAL A 6  ? ? 67.96   148.49  
72 17 ASN A 11 ? ? -150.22 86.38   
73 17 THR A 13 ? ? 52.74   141.14  
74 17 ARG A 35 ? ? -160.56 85.86   
75 18 TYR A 7  ? ? -36.40  96.93   
76 18 ASP A 10 ? ? 58.75   92.25   
77 18 ASN A 11 ? ? 58.54   94.81   
78 18 ARG A 33 ? ? 63.70   145.81  
79 19 GLU A 4  ? ? 69.57   82.36   
80 19 ASP A 10 ? ? 58.06   162.67  
81 19 ASN A 11 ? ? 47.01   85.10   
82 19 THR A 13 ? ? 52.81   140.76  
83 20 GLU A 4  ? ? -43.22  101.90  
84 20 VAL A 6  ? ? 46.08   -144.83 
85 20 TYR A 7  ? ? 54.91   76.59   
86 20 ASN A 11 ? ? 156.35  -26.12  
87 20 ALA A 12 ? ? 50.00   -164.74 
88 20 GLU A 15 ? ? 60.47   -6.69   
89 20 ARG A 33 ? ? 60.99   143.43  
# 
_pdbx_nmr_ensemble.entry_id                                      1TZ5 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with acceptable covalent geometry, structures with favorable non-bond energy, structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1TZ5 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '2mM [pNPY19-23]-hPP; 90% H2O, 10% D2O' '300mM D-38 DPC' 
2 '2mM [pNPY19-23]-hPP; 99% D2O'          '300mM D-38 DPC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D NOESY' 
2 2 1 '2D NOESY' 
# 
_pdbx_nmr_refine.entry_id           1TZ5 
_pdbx_nmr_refine.method             'Torsion angle dynamics followed by refinement in AMBER6' 
_pdbx_nmr_refine.details            'further refinement using the program AMBER (explicit solvent)' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6  collection           ?        1 
XwinNMR 2.6  processing           ?        2 
XEASY   1.53 'data analysis'      Bartels  3 
DYANA   1.5  'structure solution' Guentert 4 
DYANA   1.5  refinement           Guentert 5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
ILE N    N N N 123 
ILE CA   C N S 124 
ILE C    C N N 125 
ILE O    O N N 126 
ILE CB   C N S 127 
ILE CG1  C N N 128 
ILE CG2  C N N 129 
ILE CD1  C N N 130 
ILE OXT  O N N 131 
ILE H    H N N 132 
ILE H2   H N N 133 
ILE HA   H N N 134 
ILE HB   H N N 135 
ILE HG12 H N N 136 
ILE HG13 H N N 137 
ILE HG21 H N N 138 
ILE HG22 H N N 139 
ILE HG23 H N N 140 
ILE HD11 H N N 141 
ILE HD12 H N N 142 
ILE HD13 H N N 143 
ILE HXT  H N N 144 
LEU N    N N N 145 
LEU CA   C N S 146 
LEU C    C N N 147 
LEU O    O N N 148 
LEU CB   C N N 149 
LEU CG   C N N 150 
LEU CD1  C N N 151 
LEU CD2  C N N 152 
LEU OXT  O N N 153 
LEU H    H N N 154 
LEU H2   H N N 155 
LEU HA   H N N 156 
LEU HB2  H N N 157 
LEU HB3  H N N 158 
LEU HG   H N N 159 
LEU HD11 H N N 160 
LEU HD12 H N N 161 
LEU HD13 H N N 162 
LEU HD21 H N N 163 
LEU HD22 H N N 164 
LEU HD23 H N N 165 
LEU HXT  H N N 166 
MET N    N N N 167 
MET CA   C N S 168 
MET C    C N N 169 
MET O    O N N 170 
MET CB   C N N 171 
MET CG   C N N 172 
MET SD   S N N 173 
MET CE   C N N 174 
MET OXT  O N N 175 
MET H    H N N 176 
MET H2   H N N 177 
MET HA   H N N 178 
MET HB2  H N N 179 
MET HB3  H N N 180 
MET HG2  H N N 181 
MET HG3  H N N 182 
MET HE1  H N N 183 
MET HE2  H N N 184 
MET HE3  H N N 185 
MET HXT  H N N 186 
NH2 N    N N N 187 
NH2 HN1  H N N 188 
NH2 HN2  H N N 189 
PRO N    N N N 190 
PRO CA   C N S 191 
PRO C    C N N 192 
PRO O    O N N 193 
PRO CB   C N N 194 
PRO CG   C N N 195 
PRO CD   C N N 196 
PRO OXT  O N N 197 
PRO H    H N N 198 
PRO HA   H N N 199 
PRO HB2  H N N 200 
PRO HB3  H N N 201 
PRO HG2  H N N 202 
PRO HG3  H N N 203 
PRO HD2  H N N 204 
PRO HD3  H N N 205 
PRO HXT  H N N 206 
SER N    N N N 207 
SER CA   C N S 208 
SER C    C N N 209 
SER O    O N N 210 
SER CB   C N N 211 
SER OG   O N N 212 
SER OXT  O N N 213 
SER H    H N N 214 
SER H2   H N N 215 
SER HA   H N N 216 
SER HB2  H N N 217 
SER HB3  H N N 218 
SER HG   H N N 219 
SER HXT  H N N 220 
THR N    N N N 221 
THR CA   C N S 222 
THR C    C N N 223 
THR O    O N N 224 
THR CB   C N R 225 
THR OG1  O N N 226 
THR CG2  C N N 227 
THR OXT  O N N 228 
THR H    H N N 229 
THR H2   H N N 230 
THR HA   H N N 231 
THR HB   H N N 232 
THR HG1  H N N 233 
THR HG21 H N N 234 
THR HG22 H N N 235 
THR HG23 H N N 236 
THR HXT  H N N 237 
TYR N    N N N 238 
TYR CA   C N S 239 
TYR C    C N N 240 
TYR O    O N N 241 
TYR CB   C N N 242 
TYR CG   C Y N 243 
TYR CD1  C Y N 244 
TYR CD2  C Y N 245 
TYR CE1  C Y N 246 
TYR CE2  C Y N 247 
TYR CZ   C Y N 248 
TYR OH   O N N 249 
TYR OXT  O N N 250 
TYR H    H N N 251 
TYR H2   H N N 252 
TYR HA   H N N 253 
TYR HB2  H N N 254 
TYR HB3  H N N 255 
TYR HD1  H N N 256 
TYR HD2  H N N 257 
TYR HE1  H N N 258 
TYR HE2  H N N 259 
TYR HH   H N N 260 
TYR HXT  H N N 261 
VAL N    N N N 262 
VAL CA   C N S 263 
VAL C    C N N 264 
VAL O    O N N 265 
VAL CB   C N N 266 
VAL CG1  C N N 267 
VAL CG2  C N N 268 
VAL OXT  O N N 269 
VAL H    H N N 270 
VAL H2   H N N 271 
VAL HA   H N N 272 
VAL HB   H N N 273 
VAL HG11 H N N 274 
VAL HG12 H N N 275 
VAL HG13 H N N 276 
VAL HG21 H N N 277 
VAL HG22 H N N 278 
VAL HG23 H N N 279 
VAL HXT  H N N 280 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
ILE N   CA   sing N N 116 
ILE N   H    sing N N 117 
ILE N   H2   sing N N 118 
ILE CA  C    sing N N 119 
ILE CA  CB   sing N N 120 
ILE CA  HA   sing N N 121 
ILE C   O    doub N N 122 
ILE C   OXT  sing N N 123 
ILE CB  CG1  sing N N 124 
ILE CB  CG2  sing N N 125 
ILE CB  HB   sing N N 126 
ILE CG1 CD1  sing N N 127 
ILE CG1 HG12 sing N N 128 
ILE CG1 HG13 sing N N 129 
ILE CG2 HG21 sing N N 130 
ILE CG2 HG22 sing N N 131 
ILE CG2 HG23 sing N N 132 
ILE CD1 HD11 sing N N 133 
ILE CD1 HD12 sing N N 134 
ILE CD1 HD13 sing N N 135 
ILE OXT HXT  sing N N 136 
LEU N   CA   sing N N 137 
LEU N   H    sing N N 138 
LEU N   H2   sing N N 139 
LEU CA  C    sing N N 140 
LEU CA  CB   sing N N 141 
LEU CA  HA   sing N N 142 
LEU C   O    doub N N 143 
LEU C   OXT  sing N N 144 
LEU CB  CG   sing N N 145 
LEU CB  HB2  sing N N 146 
LEU CB  HB3  sing N N 147 
LEU CG  CD1  sing N N 148 
LEU CG  CD2  sing N N 149 
LEU CG  HG   sing N N 150 
LEU CD1 HD11 sing N N 151 
LEU CD1 HD12 sing N N 152 
LEU CD1 HD13 sing N N 153 
LEU CD2 HD21 sing N N 154 
LEU CD2 HD22 sing N N 155 
LEU CD2 HD23 sing N N 156 
LEU OXT HXT  sing N N 157 
MET N   CA   sing N N 158 
MET N   H    sing N N 159 
MET N   H2   sing N N 160 
MET CA  C    sing N N 161 
MET CA  CB   sing N N 162 
MET CA  HA   sing N N 163 
MET C   O    doub N N 164 
MET C   OXT  sing N N 165 
MET CB  CG   sing N N 166 
MET CB  HB2  sing N N 167 
MET CB  HB3  sing N N 168 
MET CG  SD   sing N N 169 
MET CG  HG2  sing N N 170 
MET CG  HG3  sing N N 171 
MET SD  CE   sing N N 172 
MET CE  HE1  sing N N 173 
MET CE  HE2  sing N N 174 
MET CE  HE3  sing N N 175 
MET OXT HXT  sing N N 176 
NH2 N   HN1  sing N N 177 
NH2 N   HN2  sing N N 178 
PRO N   CA   sing N N 179 
PRO N   CD   sing N N 180 
PRO N   H    sing N N 181 
PRO CA  C    sing N N 182 
PRO CA  CB   sing N N 183 
PRO CA  HA   sing N N 184 
PRO C   O    doub N N 185 
PRO C   OXT  sing N N 186 
PRO CB  CG   sing N N 187 
PRO CB  HB2  sing N N 188 
PRO CB  HB3  sing N N 189 
PRO CG  CD   sing N N 190 
PRO CG  HG2  sing N N 191 
PRO CG  HG3  sing N N 192 
PRO CD  HD2  sing N N 193 
PRO CD  HD3  sing N N 194 
PRO OXT HXT  sing N N 195 
SER N   CA   sing N N 196 
SER N   H    sing N N 197 
SER N   H2   sing N N 198 
SER CA  C    sing N N 199 
SER CA  CB   sing N N 200 
SER CA  HA   sing N N 201 
SER C   O    doub N N 202 
SER C   OXT  sing N N 203 
SER CB  OG   sing N N 204 
SER CB  HB2  sing N N 205 
SER CB  HB3  sing N N 206 
SER OG  HG   sing N N 207 
SER OXT HXT  sing N N 208 
THR N   CA   sing N N 209 
THR N   H    sing N N 210 
THR N   H2   sing N N 211 
THR CA  C    sing N N 212 
THR CA  CB   sing N N 213 
THR CA  HA   sing N N 214 
THR C   O    doub N N 215 
THR C   OXT  sing N N 216 
THR CB  OG1  sing N N 217 
THR CB  CG2  sing N N 218 
THR CB  HB   sing N N 219 
THR OG1 HG1  sing N N 220 
THR CG2 HG21 sing N N 221 
THR CG2 HG22 sing N N 222 
THR CG2 HG23 sing N N 223 
THR OXT HXT  sing N N 224 
TYR N   CA   sing N N 225 
TYR N   H    sing N N 226 
TYR N   H2   sing N N 227 
TYR CA  C    sing N N 228 
TYR CA  CB   sing N N 229 
TYR CA  HA   sing N N 230 
TYR C   O    doub N N 231 
TYR C   OXT  sing N N 232 
TYR CB  CG   sing N N 233 
TYR CB  HB2  sing N N 234 
TYR CB  HB3  sing N N 235 
TYR CG  CD1  doub Y N 236 
TYR CG  CD2  sing Y N 237 
TYR CD1 CE1  sing Y N 238 
TYR CD1 HD1  sing N N 239 
TYR CD2 CE2  doub Y N 240 
TYR CD2 HD2  sing N N 241 
TYR CE1 CZ   doub Y N 242 
TYR CE1 HE1  sing N N 243 
TYR CE2 CZ   sing Y N 244 
TYR CE2 HE2  sing N N 245 
TYR CZ  OH   sing N N 246 
TYR OH  HH   sing N N 247 
TYR OXT HXT  sing N N 248 
VAL N   CA   sing N N 249 
VAL N   H    sing N N 250 
VAL N   H2   sing N N 251 
VAL CA  C    sing N N 252 
VAL CA  CB   sing N N 253 
VAL CA  HA   sing N N 254 
VAL C   O    doub N N 255 
VAL C   OXT  sing N N 256 
VAL CB  CG1  sing N N 257 
VAL CB  CG2  sing N N 258 
VAL CB  HB   sing N N 259 
VAL CG1 HG11 sing N N 260 
VAL CG1 HG12 sing N N 261 
VAL CG1 HG13 sing N N 262 
VAL CG2 HG21 sing N N 263 
VAL CG2 HG22 sing N N 264 
VAL CG2 HG23 sing N N 265 
VAL OXT HXT  sing N N 266 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX    600 
2 ? Bruker AVANCE 700 
# 
_atom_sites.entry_id                    1TZ5 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_