data_1U7J # _entry.id 1U7J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1U7J pdb_00001u7j 10.2210/pdb1u7j/pdb RCSB RCSB023343 ? ? WWPDB D_1000023343 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-01 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.value' 20 4 'Structure model' '_struct_conn.pdbx_dist_value' 21 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 35 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 36 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 37 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1U7J _pdbx_database_status.recvd_initial_deposition_date 2004-08-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1EC5 'Crystal structure of four-helix bundle model' unspecified PDB 1JMO 'Crystal structure of four-helix bundle model' unspecified PDB 1JMB 'Crystal structure of four-helix bundle model' unspecified PDB 1NVO 'Solution structure of four-helix bundle model' unspecified PDB 1U7M ;Solution structure of four-helix bundle model, Due Ferri(II) turn mutant' ; unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Maglio, O.' 1 'Nastri, F.' 2 'Calhoun, J.R.' 3 'Lahr, S.' 4 'Pavone, V.' 5 'DeGrado, W.F.' 6 'Lombardi, A.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Analysis and Design of Turns in alpha-Helical Hairpins' J.Mol.Biol. 346 1441 1454 2005 JMOBAK UK 0022-2836 0070 ? 15713492 10.1016/j.jmb.2004.12.016 1 'Proton and metal ion-dependent assembly of a model diiron protein' 'Protein Sci.' 10 958 969 2001 PRCIEI US 0961-8368 0795 ? 11316876 10.1110/ps.52101 2 'Preorganization of molecular binding sites in designed diiron proteins' Proc.Natl.Acad.Sci.USA 100 3772 3777 2003 PNASA6 US 0027-8424 0040 ? 12655072 10.1073/pnas.0730771100 3 'Inaugural article: retrostructural analysis of metalloproteins: application to the design of a minimal model for diiron proteins' Proc.Natl.Acad.Sci.USA 97 6298 6305 2000 PNASA6 US 0027-8424 0040 ? 10841536 10.1073/pnas.97.12.6298 4 'Analysis and design of turns in alpha-helical hairpins' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lahr, S.J.' 1 ? primary 'Engel, D.E.' 2 ? primary 'Stayrook, S.E.' 3 ? primary 'Maglio, O.' 4 ? primary 'North, B.' 5 ? primary 'Geremia, S.' 6 ? primary 'Lombardi, A.' 7 ? primary 'Degrado, W.F.' 8 ? 1 'Pasternak, A.' 9 ? 1 'Kaplan, J.' 10 ? 1 'Lear, J.D.' 11 ? 1 'Degrado, W.F.' 12 ? 2 'Maglio, O.' 13 ? 2 'Nastri, F.' 14 ? 2 'Pavone, V.' 15 ? 2 'Lombardi, A.' 16 ? 2 'DeGrado, W.F.' 17 ? 3 'Lombardi, A.' 18 ? 3 'Summa, C.M.' 19 ? 3 'Geremia, S.' 20 ? 3 'Randaccio, L.' 21 ? 3 'Pavone, V.' 22 ? 3 'DeGrado, W.F.' 23 ? 4 'Engel, D.E.' 24 ? 4 'Lahr, S.J.' 25 ? 4 'Stayrook, S.E.' 26 ? 4 'Geremia, S.' 27 ? 4 'DeGrado, W.F.' 28 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Four-helix bundle model' 5902.705 2 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETING _entity_poly.pdbx_seq_one_letter_code_can MDYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETING _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 TYR n 1 4 LEU n 1 5 ARG n 1 6 GLU n 1 7 LEU n 1 8 TYR n 1 9 LYS n 1 10 LEU n 1 11 GLU n 1 12 GLN n 1 13 GLN n 1 14 ALA n 1 15 MET n 1 16 LYS n 1 17 LEU n 1 18 TYR n 1 19 ARG n 1 20 GLU n 1 21 ALA n 1 22 SER n 1 23 GLU n 1 24 ARG n 1 25 VAL n 1 26 GLY n 1 27 ASP n 1 28 PRO n 1 29 VAL n 1 30 LEU n 1 31 ALA n 1 32 LYS n 1 33 ILE n 1 34 LEU n 1 35 GLU n 1 36 ASP n 1 37 GLU n 1 38 GLU n 1 39 LYS n 1 40 HIS n 1 41 ILE n 1 42 GLU n 1 43 TRP n 1 44 LEU n 1 45 GLU n 1 46 THR n 1 47 ILE n 1 48 ASN n 1 49 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLY 49 49 49 GLY GLY A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ASP 2 2 2 ASP ASP B . n B 1 3 TYR 3 3 3 TYR TYR B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 ARG 5 5 5 ARG ARG B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 TYR 8 8 8 TYR TYR B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 GLN 13 13 13 GLN GLN B . n B 1 14 ALA 14 14 14 ALA ALA B . n B 1 15 MET 15 15 15 MET MET B . n B 1 16 LYS 16 16 16 LYS LYS B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 TYR 18 18 18 TYR TYR B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 GLU 20 20 20 GLU GLU B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 GLY 26 26 26 GLY GLY B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 ALA 31 31 31 ALA ALA B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 HIS 40 40 40 HIS HIS B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 TRP 43 43 43 TRP TRP B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 GLU 45 45 45 GLU GLU B . n B 1 46 THR 46 46 46 THR THR B . n B 1 47 ILE 47 47 47 ILE ILE B . n B 1 48 ASN 48 48 48 ASN ASN B . n B 1 49 GLY 49 49 49 GLY GLY B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 50 50 ZN ZN A . D 2 ZN 1 150 50 ZN ZN B . # _exptl.entry_id 1U7J _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1U7J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1U7J _struct.title 'Solution structure of a diiron protein model' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1U7J _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'Diiron proteins, four-helix bundle, protein design, inter-helical loops, DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1U7J _struct_ref.pdbx_db_accession 1U7J _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1U7J A 1 ? 49 ? 1U7J 1 ? 49 ? 1 49 2 1 1U7J B 1 ? 49 ? 1U7J 1 ? 49 ? 1 49 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 4 ? GLY A 26 ? LEU A 4 GLY A 26 1 ? 23 HELX_P HELX_P2 2 ASP A 27 ? ILE A 47 ? ASP A 27 ILE A 47 1 ? 21 HELX_P HELX_P3 3 ASP B 2 ? GLY B 26 ? ASP B 2 GLY B 26 1 ? 25 HELX_P HELX_P4 4 ASP B 27 ? ILE B 47 ? ASP B 27 ILE B 47 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 11 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 11 A ZN 50 1_555 ? ? ? ? ? ? ? 1.798 ? ? metalc2 metalc ? ? A GLU 11 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 11 A ZN 50 1_555 ? ? ? ? ? ? ? 1.913 ? ? metalc3 metalc ? ? A GLU 37 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 37 A ZN 50 1_555 ? ? ? ? ? ? ? 1.794 ? ? metalc4 metalc ? ? A GLU 37 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 37 B ZN 150 1_555 ? ? ? ? ? ? ? 1.778 ? ? metalc5 metalc ? ? A HIS 40 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 40 A ZN 50 1_555 ? ? ? ? ? ? ? 2.106 ? ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 B GLU 37 OE2 ? ? A ZN 50 B GLU 37 1_555 ? ? ? ? ? ? ? 1.781 ? ? metalc7 metalc ? ? B GLU 11 OE2 ? ? ? 1_555 D ZN . ZN ? ? B GLU 11 B ZN 150 1_555 ? ? ? ? ? ? ? 1.818 ? ? metalc8 metalc ? ? B GLU 11 OE1 ? ? ? 1_555 D ZN . ZN ? ? B GLU 11 B ZN 150 1_555 ? ? ? ? ? ? ? 1.883 ? ? metalc9 metalc ? ? B GLU 37 OE1 ? ? ? 1_555 D ZN . ZN ? ? B GLU 37 B ZN 150 1_555 ? ? ? ? ? ? ? 1.798 ? ? metalc10 metalc ? ? B HIS 40 ND1 ? ? ? 1_555 D ZN . ZN ? ? B HIS 40 B ZN 150 1_555 ? ? ? ? ? ? ? 2.099 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 64.9 ? 2 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 OE1 ? A GLU 37 ? A GLU 37 ? 1_555 127.5 ? 3 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 OE1 ? A GLU 37 ? A GLU 37 ? 1_555 91.7 ? 4 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 100.2 ? 5 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 162.0 ? 6 OE1 ? A GLU 37 ? A GLU 37 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 89.9 ? 7 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 OE2 ? B GLU 37 ? B GLU 37 ? 1_555 116.3 ? 8 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 OE2 ? B GLU 37 ? B GLU 37 ? 1_555 104.5 ? 9 OE1 ? A GLU 37 ? A GLU 37 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 OE2 ? B GLU 37 ? B GLU 37 ? 1_555 114.8 ? 10 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 ZN ? C ZN . ? A ZN 50 ? 1_555 OE2 ? B GLU 37 ? B GLU 37 ? 1_555 91.0 ? 11 OE2 ? A GLU 37 ? A GLU 37 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 OE2 ? B GLU 11 ? B GLU 11 ? 1_555 113.0 ? 12 OE2 ? A GLU 37 ? A GLU 37 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 OE1 ? B GLU 11 ? B GLU 11 ? 1_555 105.1 ? 13 OE2 ? B GLU 11 ? B GLU 11 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 OE1 ? B GLU 11 ? B GLU 11 ? 1_555 65.2 ? 14 OE2 ? A GLU 37 ? A GLU 37 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 OE1 ? B GLU 37 ? B GLU 37 ? 1_555 109.5 ? 15 OE2 ? B GLU 11 ? B GLU 11 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 OE1 ? B GLU 37 ? B GLU 37 ? 1_555 136.0 ? 16 OE1 ? B GLU 11 ? B GLU 11 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 OE1 ? B GLU 37 ? B GLU 37 ? 1_555 93.2 ? 17 OE2 ? A GLU 37 ? A GLU 37 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 ND1 ? B HIS 40 ? B HIS 40 ? 1_555 91.4 ? 18 OE2 ? B GLU 11 ? B GLU 11 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 ND1 ? B HIS 40 ? B HIS 40 ? 1_555 98.7 ? 19 OE1 ? B GLU 11 ? B GLU 11 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 ND1 ? B HIS 40 ? B HIS 40 ? 1_555 160.3 ? 20 OE1 ? B GLU 37 ? B GLU 37 ? 1_555 ZN ? D ZN . ? B ZN 150 ? 1_555 ND1 ? B HIS 40 ? B HIS 40 ? 1_555 91.3 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 50 ? 4 'BINDING SITE FOR RESIDUE ZN A 50' AC2 Software B ZN 150 ? 4 'BINDING SITE FOR RESIDUE ZN B 150' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 11 ? GLU A 11 . ? 1_555 ? 2 AC1 4 GLU A 37 ? GLU A 37 . ? 1_555 ? 3 AC1 4 HIS A 40 ? HIS A 40 . ? 1_555 ? 4 AC1 4 GLU B 37 ? GLU B 37 . ? 1_555 ? 5 AC2 4 GLU A 37 ? GLU A 37 . ? 1_555 ? 6 AC2 4 GLU B 11 ? GLU B 11 . ? 1_555 ? 7 AC2 4 GLU B 37 ? GLU B 37 . ? 1_555 ? 8 AC2 4 HIS B 40 ? HIS B 40 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HE1 A TYR 3 ? ? HB1 B ALA 21 ? ? 1.34 2 2 CE1 A TYR 3 ? ? CB B ALA 21 ? ? 1.92 3 3 HE2 A HIS 40 ? ? OD2 B ASP 36 ? ? 1.45 4 4 HB1 A ALA 14 ? ? HD13 B LEU 10 ? ? 1.02 5 4 HD12 A LEU 10 ? ? HB1 B ALA 14 ? ? 1.10 6 4 HB2 A ALA 21 ? ? CZ B TYR 3 ? ? 1.42 7 4 HB2 A ALA 21 ? ? CE1 B TYR 3 ? ? 1.57 8 4 CB A ALA 21 ? ? CZ B TYR 3 ? ? 2.17 9 7 HE3 A TRP 43 ? ? HD13 B ILE 33 ? ? 0.97 10 7 OD1 A ASP 2 ? ? HB2 B ALA 21 ? ? 1.59 11 7 OD1 A ASP 2 ? ? CB B ALA 21 ? ? 2.04 12 9 HE2 A HIS 40 ? ? OD2 B ASP 36 ? ? 1.22 13 11 OD2 A ASP 36 ? ? HE2 B HIS 40 ? ? 1.33 14 12 OH A TYR 3 ? ? HB3 B GLU 20 ? ? 1.42 15 14 HH A TYR 3 ? ? O B LEU 17 ? ? 1.49 16 18 HE2 A HIS 40 ? ? OD2 B ASP 36 ? ? 1.24 17 18 HB3 A ARG 24 ? ? HE2 B TYR 3 ? ? 1.32 18 19 HB1 A ALA 21 ? ? HE2 B TYR 3 ? ? 0.66 19 19 HE2 A TYR 3 ? ? HG22 B VAL 25 ? ? 0.95 20 19 HB1 A ALA 21 ? ? CE2 B TYR 3 ? ? 0.99 21 19 HH A TYR 3 ? ? HB2 B ARG 24 ? ? 1.02 22 19 H A ALA 21 ? ? HH B TYR 3 ? ? 1.20 23 19 HH A TYR 3 ? ? HB3 B ARG 24 ? ? 1.21 24 19 OH A TYR 3 ? ? HB2 B ARG 24 ? ? 1.23 25 19 HH A TYR 3 ? ? CB B ARG 24 ? ? 1.24 26 19 CB A ALA 21 ? ? HE2 B TYR 3 ? ? 1.31 27 19 HD12 A LEU 10 ? ? HB1 B ALA 14 ? ? 1.33 28 19 OD2 A ASP 36 ? ? HE2 B HIS 40 ? ? 1.36 29 19 HB3 A GLU 20 ? ? OH B TYR 3 ? ? 1.37 30 19 HH A TYR 18 ? ? OE2 B GLU 11 ? ? 1.40 31 19 OH A TYR 3 ? ? HB3 B ARG 24 ? ? 1.60 32 19 OH A TYR 3 ? ? CB B ARG 24 ? ? 1.74 33 19 CB A ALA 21 ? ? CE2 B TYR 3 ? ? 2.06 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 106.68 123.30 -16.62 1.20 N 2 1 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 106.70 123.30 -16.60 1.20 N 3 2 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.23 123.30 -16.07 1.20 N 4 2 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 106.77 123.30 -16.53 1.20 N 5 3 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.57 123.30 -15.73 1.20 N 6 3 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.36 123.30 -15.94 1.20 N 7 4 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 106.87 123.30 -16.43 1.20 N 8 4 OE1 A GLU 37 ? ? CD A GLU 37 ? ? OE2 A GLU 37 ? ? 115.51 123.30 -7.79 1.20 N 9 4 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.11 123.30 -16.19 1.20 N 10 4 OE1 B GLU 37 ? ? CD B GLU 37 ? ? OE2 B GLU 37 ? ? 115.19 123.30 -8.11 1.20 N 11 5 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.42 123.30 -15.88 1.20 N 12 5 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.12 123.30 -16.18 1.20 N 13 6 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.42 123.30 -15.88 1.20 N 14 6 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.02 123.30 -16.28 1.20 N 15 7 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 106.88 123.30 -16.42 1.20 N 16 7 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.17 123.30 -16.13 1.20 N 17 7 NE B ARG 19 ? ? CZ B ARG 19 ? ? NH1 B ARG 19 ? ? 123.50 120.30 3.20 0.50 N 18 8 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.46 123.30 -15.84 1.20 N 19 8 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.71 123.30 -15.59 1.20 N 20 9 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.37 123.30 -15.93 1.20 N 21 9 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.52 123.30 -15.78 1.20 N 22 10 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.58 123.30 -15.72 1.20 N 23 10 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.63 123.30 -15.67 1.20 N 24 11 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 106.65 123.30 -16.65 1.20 N 25 11 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.15 123.30 -16.15 1.20 N 26 12 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.15 123.30 -16.15 1.20 N 27 12 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 106.87 123.30 -16.43 1.20 N 28 13 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 106.86 123.30 -16.44 1.20 N 29 13 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.51 123.30 -15.79 1.20 N 30 14 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.10 123.30 -16.20 1.20 N 31 14 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 106.39 123.30 -16.91 1.20 N 32 15 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.57 123.30 -15.73 1.20 N 33 15 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.64 123.30 -15.66 1.20 N 34 16 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.20 123.30 -16.10 1.20 N 35 16 OE1 A GLU 37 ? ? CD A GLU 37 ? ? OE2 A GLU 37 ? ? 115.19 123.30 -8.11 1.20 N 36 16 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.32 123.30 -15.98 1.20 N 37 16 OE1 B GLU 37 ? ? CD B GLU 37 ? ? OE2 B GLU 37 ? ? 115.77 123.30 -7.53 1.20 N 38 17 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.23 123.30 -16.07 1.20 N 39 17 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.62 123.30 -15.68 1.20 N 40 18 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.59 123.30 -15.71 1.20 N 41 18 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.07 123.30 -16.23 1.20 N 42 19 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.25 123.30 -16.05 1.20 N 43 19 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.34 120.30 3.04 0.50 N 44 19 NE B ARG 5 ? ? CZ B ARG 5 ? ? NH1 B ARG 5 ? ? 123.87 120.30 3.57 0.50 N 45 19 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 107.31 123.30 -15.99 1.20 N 46 20 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 107.31 123.30 -15.99 1.20 N 47 20 OE1 B GLU 11 ? ? CD B GLU 11 ? ? OE2 B GLU 11 ? ? 106.98 123.30 -16.32 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 3 ? ? -129.40 -56.48 2 1 ASP B 2 ? ? -148.57 -7.06 3 2 TYR A 3 ? ? -172.89 -62.32 4 2 ILE A 47 ? ? -59.51 -7.96 5 2 TYR B 3 ? ? -152.13 -38.16 6 3 TYR B 3 ? ? -160.05 -39.58 7 3 LYS B 9 ? ? -69.11 0.28 8 3 ALA B 14 ? ? -72.09 46.09 9 3 MET B 15 ? ? -149.65 -48.06 10 4 TYR A 3 ? ? -145.64 -63.37 11 4 ALA A 14 ? ? -68.74 52.03 12 4 MET A 15 ? ? -160.62 -53.10 13 4 GLU A 37 ? ? -67.77 6.26 14 4 ASP B 2 ? ? -173.25 -56.49 15 4 SER B 22 ? ? -124.80 -50.70 16 4 ASN B 48 ? ? -82.05 -76.86 17 5 ALA A 21 ? ? -78.23 40.48 18 5 TYR B 3 ? ? -165.97 -39.56 19 5 LYS B 9 ? ? -66.29 4.45 20 5 VAL B 25 ? ? -135.32 -50.97 21 6 TYR A 3 ? ? -158.39 -42.95 22 6 ALA A 14 ? ? -70.34 40.22 23 6 MET A 15 ? ? -139.32 -52.08 24 6 TYR B 3 ? ? -137.16 -46.96 25 6 SER B 22 ? ? -125.24 -50.15 26 7 ASP A 2 ? ? 48.04 19.36 27 7 LYS A 9 ? ? -69.79 4.98 28 7 SER A 22 ? ? -133.97 -49.99 29 7 TYR B 3 ? ? -131.25 -155.95 30 7 ASN B 48 ? ? -140.68 15.02 31 8 ALA A 14 ? ? -72.44 42.72 32 8 MET A 15 ? ? -149.28 -43.02 33 8 TYR B 3 ? ? -155.51 -46.89 34 8 MET B 15 ? ? -151.73 -50.50 35 8 HIS B 40 ? ? -57.74 -0.66 36 9 TYR A 3 ? ? -151.52 -67.92 37 9 HIS A 40 ? ? -54.77 -9.41 38 9 TYR B 3 ? ? -127.77 -67.78 39 9 LYS B 9 ? ? -66.16 1.57 40 9 ALA B 21 ? ? -80.37 41.17 41 10 ASP A 2 ? ? -171.37 -34.63 42 10 VAL A 25 ? ? -144.53 -57.19 43 10 ASP A 27 ? ? 48.87 129.84 44 10 HIS A 40 ? ? -57.08 -6.30 45 10 TYR B 3 ? ? -143.96 -51.34 46 11 ASP A 2 ? ? 176.26 -20.17 47 11 LYS A 9 ? ? -65.88 2.89 48 11 ALA A 14 ? ? -67.52 59.68 49 11 MET A 15 ? ? -158.31 -51.78 50 11 VAL A 25 ? ? -151.53 -69.12 51 11 ASP A 27 ? ? 70.47 136.04 52 11 ALA A 31 ? ? -64.12 0.14 53 11 ALA B 14 ? ? -69.86 46.07 54 11 MET B 15 ? ? -145.56 -45.67 55 12 TYR A 3 ? ? 61.73 -48.54 56 12 LYS A 9 ? ? -69.02 7.11 57 12 VAL A 25 ? ? -131.60 -32.64 58 12 ASP B 2 ? ? -147.49 -60.42 59 12 TYR B 3 ? ? -147.48 -41.05 60 12 LEU B 4 ? ? -29.97 -45.79 61 12 VAL B 25 ? ? -135.38 -54.78 62 13 TYR A 3 ? ? 48.49 -7.93 63 13 ALA A 14 ? ? -72.04 47.85 64 13 MET A 15 ? ? -153.35 -53.36 65 13 TYR B 3 ? ? -147.79 -50.95 66 14 TYR A 3 ? ? -144.51 -69.16 67 14 LYS A 9 ? ? -70.00 8.32 68 14 LYS B 9 ? ? -68.04 5.81 69 15 ASP A 2 ? ? -167.48 -34.11 70 15 TYR A 3 ? ? -49.99 -19.84 71 15 ASP B 2 ? ? -156.21 -47.28 72 15 TYR B 3 ? ? -126.64 -53.18 73 15 VAL B 25 ? ? -143.82 -56.17 74 16 ASP A 2 ? ? -161.57 -46.17 75 16 VAL A 25 ? ? -138.29 -60.98 76 16 ASN A 48 ? ? -143.52 15.22 77 16 TYR B 3 ? ? -142.80 -68.82 78 16 ALA B 21 ? ? -74.43 48.12 79 16 HIS B 40 ? ? -58.48 -1.31 80 17 ASP A 2 ? ? -128.57 -59.24 81 17 TYR A 3 ? ? -170.68 -150.26 82 17 LYS A 9 ? ? -67.60 1.20 83 17 VAL A 25 ? ? -138.48 -50.16 84 17 HIS A 40 ? ? -54.69 -6.59 85 17 TYR B 3 ? ? -139.25 -41.12 86 17 LYS B 9 ? ? -68.86 6.93 87 18 ASP A 2 ? ? 67.67 -179.95 88 18 TYR A 3 ? ? -111.29 -82.06 89 18 LYS A 9 ? ? -69.99 2.58 90 18 ASP B 2 ? ? 65.18 -15.21 91 18 SER B 22 ? ? -133.63 -46.29 92 19 ASP A 2 ? ? -78.45 47.64 93 19 TYR A 3 ? ? -142.49 -50.01 94 19 VAL A 25 ? ? -132.14 -31.03 95 19 ASN A 48 ? ? -141.03 -11.18 96 19 TYR B 3 ? ? -148.25 -56.13 97 19 LYS B 9 ? ? -68.08 4.43 98 20 ASP A 2 ? ? -145.28 -42.79 99 20 VAL A 25 ? ? -140.74 -55.82 100 20 ASP A 27 ? ? 47.44 131.37 101 20 TYR B 3 ? ? -148.40 -62.04 102 20 GLU B 23 ? ? -65.35 2.91 103 20 ARG B 24 ? ? -131.79 -39.61 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 7 _pdbx_validate_peptide_omega.auth_comp_id_1 TYR _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 3 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LEU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 4 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -149.73 # _pdbx_nmr_ensemble.entry_id 1U7J _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1U7J _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5mM protein concentration; 50mM phosphate buffer; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure Ambient _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D TOCSY' 2 1 1 DQF-COSY 3 1 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1U7J _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_refine.entry_id 1U7J _pdbx_nmr_refine.method 'Torsion Angle Dynamics, Simulated Annealing, Energy Restrained Minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 1.7 processing 'Delaglio et al.' 1 DYANA 1.5 'structure solution' 'Guentert et al.' 2 Amber 7.0 refinement 'Case et al.' 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TRP N N N N 281 TRP CA C N S 282 TRP C C N N 283 TRP O O N N 284 TRP CB C N N 285 TRP CG C Y N 286 TRP CD1 C Y N 287 TRP CD2 C Y N 288 TRP NE1 N Y N 289 TRP CE2 C Y N 290 TRP CE3 C Y N 291 TRP CZ2 C Y N 292 TRP CZ3 C Y N 293 TRP CH2 C Y N 294 TRP OXT O N N 295 TRP H H N N 296 TRP H2 H N N 297 TRP HA H N N 298 TRP HB2 H N N 299 TRP HB3 H N N 300 TRP HD1 H N N 301 TRP HE1 H N N 302 TRP HE3 H N N 303 TRP HZ2 H N N 304 TRP HZ3 H N N 305 TRP HH2 H N N 306 TRP HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 ZN ZN ZN N N 351 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TRP N CA sing N N 268 TRP N H sing N N 269 TRP N H2 sing N N 270 TRP CA C sing N N 271 TRP CA CB sing N N 272 TRP CA HA sing N N 273 TRP C O doub N N 274 TRP C OXT sing N N 275 TRP CB CG sing N N 276 TRP CB HB2 sing N N 277 TRP CB HB3 sing N N 278 TRP CG CD1 doub Y N 279 TRP CG CD2 sing Y N 280 TRP CD1 NE1 sing Y N 281 TRP CD1 HD1 sing N N 282 TRP CD2 CE2 doub Y N 283 TRP CD2 CE3 sing Y N 284 TRP NE1 CE2 sing Y N 285 TRP NE1 HE1 sing N N 286 TRP CE2 CZ2 sing Y N 287 TRP CE3 CZ3 doub Y N 288 TRP CE3 HE3 sing N N 289 TRP CZ2 CH2 doub Y N 290 TRP CZ2 HZ2 sing N N 291 TRP CZ3 CH2 sing Y N 292 TRP CZ3 HZ3 sing N N 293 TRP CH2 HH2 sing N N 294 TRP OXT HXT sing N N 295 TYR N CA sing N N 296 TYR N H sing N N 297 TYR N H2 sing N N 298 TYR CA C sing N N 299 TYR CA CB sing N N 300 TYR CA HA sing N N 301 TYR C O doub N N 302 TYR C OXT sing N N 303 TYR CB CG sing N N 304 TYR CB HB2 sing N N 305 TYR CB HB3 sing N N 306 TYR CG CD1 doub Y N 307 TYR CG CD2 sing Y N 308 TYR CD1 CE1 sing Y N 309 TYR CD1 HD1 sing N N 310 TYR CD2 CE2 doub Y N 311 TYR CD2 HD2 sing N N 312 TYR CE1 CZ doub Y N 313 TYR CE1 HE1 sing N N 314 TYR CE2 CZ sing Y N 315 TYR CE2 HE2 sing N N 316 TYR CZ OH sing N N 317 TYR OH HH sing N N 318 TYR OXT HXT sing N N 319 VAL N CA sing N N 320 VAL N H sing N N 321 VAL N H2 sing N N 322 VAL CA C sing N N 323 VAL CA CB sing N N 324 VAL CA HA sing N N 325 VAL C O doub N N 326 VAL C OXT sing N N 327 VAL CB CG1 sing N N 328 VAL CB CG2 sing N N 329 VAL CB HB sing N N 330 VAL CG1 HG11 sing N N 331 VAL CG1 HG12 sing N N 332 VAL CG1 HG13 sing N N 333 VAL CG2 HG21 sing N N 334 VAL CG2 HG22 sing N N 335 VAL CG2 HG23 sing N N 336 VAL OXT HXT sing N N 337 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1U7J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_