data_1U9N # _entry.id 1U9N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1U9N RCSB RCSB023417 WWPDB D_1000023417 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1U9O _pdbx_database_related.details 'the same protein without ligand' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1U9N _pdbx_database_status.recvd_initial_deposition_date 2004-08-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Frenois, F.' 1 'Engohang-Ndong, J.' 2 'Locht, C.' 3 'Baulard, A.R.' 4 'Villeret, V.' 5 # _citation.id primary _citation.title 'Structure of EthR in a Ligand Bound Conformation Reveals Therapeutic Perspectives against Tuberculosis' _citation.journal_abbrev Mol.Cell _citation.journal_volume 16 _citation.page_first 301 _citation.page_last 307 _citation.year 2004 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15494316 _citation.pdbx_database_id_DOI 10.1016/j.molcel.2004.09.020 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Frenois, F.' 1 primary 'Engohang-Ndong, J.' 2 primary 'Locht, C.' 3 primary 'Baulard, A.R.' 4 primary 'Villeret, V.' 5 # _cell.entry_id 1U9N _cell.length_a 122.380 _cell.length_b 122.380 _cell.length_c 33.570 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1U9N _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional repressor EthR' 26155.486 1 ? ? ? ? 2 non-polymer syn 'HEXADECYL OCTANOATE' 368.637 1 ? ? ? ? 3 water nat water 18.015 105 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSSHHHHHHSSGLVPRGSHVTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGI SRPTFYFYFPSKEAVLLTLLDRVVNQAD(MSE)ALQTLAENPADTDREN(MSE)WRTGINVFFETFGSHKAVTRAGQAAR ATSVEVAELWSTF(MSE)QKWIAYTAAVIDAERDRGAAPRTLPAHELATALNL(MSE)NERTLFASFAGEQPSVPEARVL DTLVHIWVTSIYGENR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHVTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWST FMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 VAL n 1 22 THR n 1 23 THR n 1 24 SER n 1 25 ALA n 1 26 ALA n 1 27 SER n 1 28 GLN n 1 29 ALA n 1 30 SER n 1 31 LEU n 1 32 PRO n 1 33 ARG n 1 34 GLY n 1 35 ARG n 1 36 ARG n 1 37 THR n 1 38 ALA n 1 39 ARG n 1 40 PRO n 1 41 SER n 1 42 GLY n 1 43 ASP n 1 44 ASP n 1 45 ARG n 1 46 GLU n 1 47 LEU n 1 48 ALA n 1 49 ILE n 1 50 LEU n 1 51 ALA n 1 52 THR n 1 53 ALA n 1 54 GLU n 1 55 ASN n 1 56 LEU n 1 57 LEU n 1 58 GLU n 1 59 ASP n 1 60 ARG n 1 61 PRO n 1 62 LEU n 1 63 ALA n 1 64 ASP n 1 65 ILE n 1 66 SER n 1 67 VAL n 1 68 ASP n 1 69 ASP n 1 70 LEU n 1 71 ALA n 1 72 LYS n 1 73 GLY n 1 74 ALA n 1 75 GLY n 1 76 ILE n 1 77 SER n 1 78 ARG n 1 79 PRO n 1 80 THR n 1 81 PHE n 1 82 TYR n 1 83 PHE n 1 84 TYR n 1 85 PHE n 1 86 PRO n 1 87 SER n 1 88 LYS n 1 89 GLU n 1 90 ALA n 1 91 VAL n 1 92 LEU n 1 93 LEU n 1 94 THR n 1 95 LEU n 1 96 LEU n 1 97 ASP n 1 98 ARG n 1 99 VAL n 1 100 VAL n 1 101 ASN n 1 102 GLN n 1 103 ALA n 1 104 ASP n 1 105 MSE n 1 106 ALA n 1 107 LEU n 1 108 GLN n 1 109 THR n 1 110 LEU n 1 111 ALA n 1 112 GLU n 1 113 ASN n 1 114 PRO n 1 115 ALA n 1 116 ASP n 1 117 THR n 1 118 ASP n 1 119 ARG n 1 120 GLU n 1 121 ASN n 1 122 MSE n 1 123 TRP n 1 124 ARG n 1 125 THR n 1 126 GLY n 1 127 ILE n 1 128 ASN n 1 129 VAL n 1 130 PHE n 1 131 PHE n 1 132 GLU n 1 133 THR n 1 134 PHE n 1 135 GLY n 1 136 SER n 1 137 HIS n 1 138 LYS n 1 139 ALA n 1 140 VAL n 1 141 THR n 1 142 ARG n 1 143 ALA n 1 144 GLY n 1 145 GLN n 1 146 ALA n 1 147 ALA n 1 148 ARG n 1 149 ALA n 1 150 THR n 1 151 SER n 1 152 VAL n 1 153 GLU n 1 154 VAL n 1 155 ALA n 1 156 GLU n 1 157 LEU n 1 158 TRP n 1 159 SER n 1 160 THR n 1 161 PHE n 1 162 MSE n 1 163 GLN n 1 164 LYS n 1 165 TRP n 1 166 ILE n 1 167 ALA n 1 168 TYR n 1 169 THR n 1 170 ALA n 1 171 ALA n 1 172 VAL n 1 173 ILE n 1 174 ASP n 1 175 ALA n 1 176 GLU n 1 177 ARG n 1 178 ASP n 1 179 ARG n 1 180 GLY n 1 181 ALA n 1 182 ALA n 1 183 PRO n 1 184 ARG n 1 185 THR n 1 186 LEU n 1 187 PRO n 1 188 ALA n 1 189 HIS n 1 190 GLU n 1 191 LEU n 1 192 ALA n 1 193 THR n 1 194 ALA n 1 195 LEU n 1 196 ASN n 1 197 LEU n 1 198 MSE n 1 199 ASN n 1 200 GLU n 1 201 ARG n 1 202 THR n 1 203 LEU n 1 204 PHE n 1 205 ALA n 1 206 SER n 1 207 PHE n 1 208 ALA n 1 209 GLY n 1 210 GLU n 1 211 GLN n 1 212 PRO n 1 213 SER n 1 214 VAL n 1 215 PRO n 1 216 GLU n 1 217 ALA n 1 218 ARG n 1 219 VAL n 1 220 LEU n 1 221 ASP n 1 222 THR n 1 223 LEU n 1 224 VAL n 1 225 HIS n 1 226 ILE n 1 227 TRP n 1 228 VAL n 1 229 THR n 1 230 SER n 1 231 ILE n 1 232 TYR n 1 233 GLY n 1 234 GLU n 1 235 ASN n 1 236 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Mycobacterium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code P96222_MYCTU _struct_ref.pdbx_db_accession P96222 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1U9N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P96222 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 216 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 216 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CNS non-polymer . 'HEXADECYL OCTANOATE' ? 'C24 H48 O2' 368.637 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1U9N _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_percent_sol 48.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details 'glycerol, polyethylene glycol 8000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2003-11-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9799 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9799 # _refine.entry_id 1U9N _refine.ls_d_res_high 2.3 _refine.ls_d_res_low 15 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 21577 _refine.ls_number_reflns_obs 21564 _refine.ls_number_reflns_R_free ? _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_all 0.208 _refine.ls_R_factor_obs 0.208 _refine.ls_R_factor_R_work 0.201 _refine.ls_R_factor_R_free 0.231 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1510 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 105 _refine_hist.number_atoms_total 1641 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 15 # _struct.entry_id 1U9N _struct.title ;Crystal structure of the transcriptional regulator EthR in a ligand bound conformation opens therapeutic perspectives against tuberculosis and leprosy ; _struct.pdbx_descriptor 'Transcriptional repressor EthR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1U9N _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'TetR family, transcriptional repressor, protein-ligand complex, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 42 ? LEU A 57 ? GLY A 22 LEU A 37 1 ? 16 HELX_P HELX_P2 2 PRO A 61 ? ILE A 65 ? PRO A 41 ILE A 45 5 ? 5 HELX_P HELX_P3 3 SER A 66 ? GLY A 75 ? SER A 46 GLY A 55 1 ? 10 HELX_P HELX_P4 4 SER A 77 ? TYR A 82 ? SER A 57 TYR A 62 1 ? 6 HELX_P HELX_P5 5 SER A 87 ? ASN A 113 ? SER A 67 ASN A 93 1 ? 27 HELX_P HELX_P6 6 ASP A 118 ? SER A 136 ? ASP A 98 SER A 116 1 ? 19 HELX_P HELX_P7 7 HIS A 137 ? ARG A 148 ? HIS A 117 ARG A 128 1 ? 12 HELX_P HELX_P8 8 SER A 151 ? ARG A 179 ? SER A 131 ARG A 159 1 ? 29 HELX_P HELX_P9 9 PRO A 187 ? GLY A 209 ? PRO A 167 GLY A 189 1 ? 23 HELX_P HELX_P10 10 PRO A 215 ? GLY A 233 ? PRO A 195 GLY A 213 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ASP 104 C ? ? ? 1_555 A MSE 105 N ? ? A ASP 84 A MSE 85 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A MSE 105 C ? ? ? 1_555 A ALA 106 N ? ? A MSE 85 A ALA 86 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A ASN 121 C ? ? ? 1_555 A MSE 122 N ? ? A ASN 101 A MSE 102 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale ? ? A MSE 122 C ? ? ? 1_555 A TRP 123 N ? ? A MSE 102 A TRP 103 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale ? ? A PHE 161 C ? ? ? 1_555 A MSE 162 N ? ? A PHE 141 A MSE 142 1_555 ? ? ? ? ? ? ? 1.332 ? covale6 covale ? ? A MSE 162 C ? ? ? 1_555 A GLN 163 N ? ? A MSE 142 A GLN 143 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale ? ? A LEU 197 C ? ? ? 1_555 A MSE 198 N ? ? A LEU 177 A MSE 178 1_555 ? ? ? ? ? ? ? 1.332 ? covale8 covale ? ? A MSE 198 C ? ? ? 1_555 A ASN 199 N ? ? A MSE 178 A ASN 179 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 211 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 191 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 212 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 192 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.24 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'BINDING SITE FOR RESIDUE CNS A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 TRP A 123 ? TRP A 103 . ? 1_555 ? 2 AC1 12 GLY A 126 ? GLY A 106 . ? 1_555 ? 3 AC1 12 ILE A 127 ? ILE A 107 . ? 1_555 ? 4 AC1 12 PHE A 130 ? PHE A 110 . ? 1_555 ? 5 AC1 12 THR A 141 ? THR A 121 . ? 1_555 ? 6 AC1 12 GLY A 144 ? GLY A 124 . ? 1_555 ? 7 AC1 12 GLN A 145 ? GLN A 125 . ? 1_555 ? 8 AC1 12 ARG A 148 ? ARG A 128 . ? 1_555 ? 9 AC1 12 TRP A 158 ? TRP A 138 . ? 1_555 ? 10 AC1 12 ASN A 196 ? ASN A 176 . ? 1_555 ? 11 AC1 12 GLU A 200 ? GLU A 180 . ? 1_555 ? 12 AC1 12 PHE A 204 ? PHE A 184 . ? 1_555 ? # _database_PDB_matrix.entry_id 1U9N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1U9N _atom_sites.fract_transf_matrix[1][1] 0.008171 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008171 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029789 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 VAL 21 1 ? ? ? A . n A 1 22 THR 22 2 ? ? ? A . n A 1 23 THR 23 3 ? ? ? A . n A 1 24 SER 24 4 ? ? ? A . n A 1 25 ALA 25 5 ? ? ? A . n A 1 26 ALA 26 6 ? ? ? A . n A 1 27 SER 27 7 ? ? ? A . n A 1 28 GLN 28 8 ? ? ? A . n A 1 29 ALA 29 9 ? ? ? A . n A 1 30 SER 30 10 ? ? ? A . n A 1 31 LEU 31 11 ? ? ? A . n A 1 32 PRO 32 12 ? ? ? A . n A 1 33 ARG 33 13 ? ? ? A . n A 1 34 GLY 34 14 ? ? ? A . n A 1 35 ARG 35 15 ? ? ? A . n A 1 36 ARG 36 16 ? ? ? A . n A 1 37 THR 37 17 ? ? ? A . n A 1 38 ALA 38 18 ? ? ? A . n A 1 39 ARG 39 19 ? ? ? A . n A 1 40 PRO 40 20 ? ? ? A . n A 1 41 SER 41 21 ? ? ? A . n A 1 42 GLY 42 22 22 GLY GLY A . n A 1 43 ASP 43 23 23 ASP ASP A . n A 1 44 ASP 44 24 24 ASP ASP A . n A 1 45 ARG 45 25 25 ARG ARG A . n A 1 46 GLU 46 26 26 GLU GLU A . n A 1 47 LEU 47 27 27 LEU LEU A . n A 1 48 ALA 48 28 28 ALA ALA A . n A 1 49 ILE 49 29 29 ILE ILE A . n A 1 50 LEU 50 30 30 LEU LEU A . n A 1 51 ALA 51 31 31 ALA ALA A . n A 1 52 THR 52 32 32 THR THR A . n A 1 53 ALA 53 33 33 ALA ALA A . n A 1 54 GLU 54 34 34 GLU GLU A . n A 1 55 ASN 55 35 35 ASN ASN A . n A 1 56 LEU 56 36 36 LEU LEU A . n A 1 57 LEU 57 37 37 LEU LEU A . n A 1 58 GLU 58 38 38 GLU GLU A . n A 1 59 ASP 59 39 39 ASP ASP A . n A 1 60 ARG 60 40 40 ARG ARG A . n A 1 61 PRO 61 41 41 PRO PRO A . n A 1 62 LEU 62 42 42 LEU LEU A . n A 1 63 ALA 63 43 43 ALA ALA A . n A 1 64 ASP 64 44 44 ASP ASP A . n A 1 65 ILE 65 45 45 ILE ILE A . n A 1 66 SER 66 46 46 SER SER A . n A 1 67 VAL 67 47 47 VAL VAL A . n A 1 68 ASP 68 48 48 ASP ASP A . n A 1 69 ASP 69 49 49 ASP ASP A . n A 1 70 LEU 70 50 50 LEU LEU A . n A 1 71 ALA 71 51 51 ALA ALA A . n A 1 72 LYS 72 52 52 LYS LYS A . n A 1 73 GLY 73 53 53 GLY GLY A . n A 1 74 ALA 74 54 54 ALA ALA A . n A 1 75 GLY 75 55 55 GLY GLY A . n A 1 76 ILE 76 56 56 ILE ILE A . n A 1 77 SER 77 57 57 SER SER A . n A 1 78 ARG 78 58 58 ARG ARG A . n A 1 79 PRO 79 59 59 PRO PRO A . n A 1 80 THR 80 60 60 THR THR A . n A 1 81 PHE 81 61 61 PHE PHE A . n A 1 82 TYR 82 62 62 TYR TYR A . n A 1 83 PHE 83 63 63 PHE PHE A . n A 1 84 TYR 84 64 64 TYR TYR A . n A 1 85 PHE 85 65 65 PHE PHE A . n A 1 86 PRO 86 66 66 PRO PRO A . n A 1 87 SER 87 67 67 SER SER A . n A 1 88 LYS 88 68 68 LYS LYS A . n A 1 89 GLU 89 69 69 GLU GLU A . n A 1 90 ALA 90 70 70 ALA ALA A . n A 1 91 VAL 91 71 71 VAL VAL A . n A 1 92 LEU 92 72 72 LEU LEU A . n A 1 93 LEU 93 73 73 LEU LEU A . n A 1 94 THR 94 74 74 THR THR A . n A 1 95 LEU 95 75 75 LEU LEU A . n A 1 96 LEU 96 76 76 LEU LEU A . n A 1 97 ASP 97 77 77 ASP ASP A . n A 1 98 ARG 98 78 78 ARG ARG A . n A 1 99 VAL 99 79 79 VAL VAL A . n A 1 100 VAL 100 80 80 VAL VAL A . n A 1 101 ASN 101 81 81 ASN ASN A . n A 1 102 GLN 102 82 82 GLN GLN A . n A 1 103 ALA 103 83 83 ALA ALA A . n A 1 104 ASP 104 84 84 ASP ASP A . n A 1 105 MSE 105 85 85 MSE MSE A . n A 1 106 ALA 106 86 86 ALA ALA A . n A 1 107 LEU 107 87 87 LEU LEU A . n A 1 108 GLN 108 88 88 GLN GLN A . n A 1 109 THR 109 89 89 THR THR A . n A 1 110 LEU 110 90 90 LEU LEU A . n A 1 111 ALA 111 91 91 ALA ALA A . n A 1 112 GLU 112 92 92 GLU GLU A . n A 1 113 ASN 113 93 93 ASN ASN A . n A 1 114 PRO 114 94 94 PRO PRO A . n A 1 115 ALA 115 95 95 ALA ALA A . n A 1 116 ASP 116 96 96 ASP ASP A . n A 1 117 THR 117 97 97 THR THR A . n A 1 118 ASP 118 98 98 ASP ASP A . n A 1 119 ARG 119 99 99 ARG ARG A . n A 1 120 GLU 120 100 100 GLU GLU A . n A 1 121 ASN 121 101 101 ASN ASN A . n A 1 122 MSE 122 102 102 MSE MSE A . n A 1 123 TRP 123 103 103 TRP TRP A . n A 1 124 ARG 124 104 104 ARG ARG A . n A 1 125 THR 125 105 105 THR THR A . n A 1 126 GLY 126 106 106 GLY GLY A . n A 1 127 ILE 127 107 107 ILE ILE A . n A 1 128 ASN 128 108 108 ASN ASN A . n A 1 129 VAL 129 109 109 VAL VAL A . n A 1 130 PHE 130 110 110 PHE PHE A . n A 1 131 PHE 131 111 111 PHE PHE A . n A 1 132 GLU 132 112 112 GLU GLU A . n A 1 133 THR 133 113 113 THR THR A . n A 1 134 PHE 134 114 114 PHE PHE A . n A 1 135 GLY 135 115 115 GLY GLY A . n A 1 136 SER 136 116 116 SER SER A . n A 1 137 HIS 137 117 117 HIS HIS A . n A 1 138 LYS 138 118 118 LYS LYS A . n A 1 139 ALA 139 119 119 ALA ALA A . n A 1 140 VAL 140 120 120 VAL VAL A . n A 1 141 THR 141 121 121 THR THR A . n A 1 142 ARG 142 122 122 ARG ARG A . n A 1 143 ALA 143 123 123 ALA ALA A . n A 1 144 GLY 144 124 124 GLY GLY A . n A 1 145 GLN 145 125 125 GLN GLN A . n A 1 146 ALA 146 126 126 ALA ALA A . n A 1 147 ALA 147 127 127 ALA ALA A . n A 1 148 ARG 148 128 128 ARG ARG A . n A 1 149 ALA 149 129 129 ALA ALA A . n A 1 150 THR 150 130 130 THR THR A . n A 1 151 SER 151 131 131 SER SER A . n A 1 152 VAL 152 132 132 VAL VAL A . n A 1 153 GLU 153 133 133 GLU GLU A . n A 1 154 VAL 154 134 134 VAL VAL A . n A 1 155 ALA 155 135 135 ALA ALA A . n A 1 156 GLU 156 136 136 GLU GLU A . n A 1 157 LEU 157 137 137 LEU LEU A . n A 1 158 TRP 158 138 138 TRP TRP A . n A 1 159 SER 159 139 139 SER SER A . n A 1 160 THR 160 140 140 THR THR A . n A 1 161 PHE 161 141 141 PHE PHE A . n A 1 162 MSE 162 142 142 MSE MSE A . n A 1 163 GLN 163 143 143 GLN GLN A . n A 1 164 LYS 164 144 144 LYS LYS A . n A 1 165 TRP 165 145 145 TRP TRP A . n A 1 166 ILE 166 146 146 ILE ILE A . n A 1 167 ALA 167 147 147 ALA ALA A . n A 1 168 TYR 168 148 148 TYR TYR A . n A 1 169 THR 169 149 149 THR THR A . n A 1 170 ALA 170 150 150 ALA ALA A . n A 1 171 ALA 171 151 151 ALA ALA A . n A 1 172 VAL 172 152 152 VAL VAL A . n A 1 173 ILE 173 153 153 ILE ILE A . n A 1 174 ASP 174 154 154 ASP ASP A . n A 1 175 ALA 175 155 155 ALA ALA A . n A 1 176 GLU 176 156 156 GLU GLU A . n A 1 177 ARG 177 157 157 ARG ARG A . n A 1 178 ASP 178 158 158 ASP ASP A . n A 1 179 ARG 179 159 159 ARG ARG A . n A 1 180 GLY 180 160 160 GLY GLY A . n A 1 181 ALA 181 161 161 ALA ALA A . n A 1 182 ALA 182 162 162 ALA ALA A . n A 1 183 PRO 183 163 163 PRO PRO A . n A 1 184 ARG 184 164 164 ARG ARG A . n A 1 185 THR 185 165 165 THR THR A . n A 1 186 LEU 186 166 166 LEU LEU A . n A 1 187 PRO 187 167 167 PRO PRO A . n A 1 188 ALA 188 168 168 ALA ALA A . n A 1 189 HIS 189 169 169 HIS HIS A . n A 1 190 GLU 190 170 170 GLU GLU A . n A 1 191 LEU 191 171 171 LEU LEU A . n A 1 192 ALA 192 172 172 ALA ALA A . n A 1 193 THR 193 173 173 THR THR A . n A 1 194 ALA 194 174 174 ALA ALA A . n A 1 195 LEU 195 175 175 LEU LEU A . n A 1 196 ASN 196 176 176 ASN ASN A . n A 1 197 LEU 197 177 177 LEU LEU A . n A 1 198 MSE 198 178 178 MSE MSE A . n A 1 199 ASN 199 179 179 ASN ASN A . n A 1 200 GLU 200 180 180 GLU GLU A . n A 1 201 ARG 201 181 181 ARG ARG A . n A 1 202 THR 202 182 182 THR THR A . n A 1 203 LEU 203 183 183 LEU LEU A . n A 1 204 PHE 204 184 184 PHE PHE A . n A 1 205 ALA 205 185 185 ALA ALA A . n A 1 206 SER 206 186 186 SER SER A . n A 1 207 PHE 207 187 187 PHE PHE A . n A 1 208 ALA 208 188 188 ALA ALA A . n A 1 209 GLY 209 189 189 GLY GLY A . n A 1 210 GLU 210 190 190 GLU GLU A . n A 1 211 GLN 211 191 191 GLN GLN A . n A 1 212 PRO 212 192 192 PRO CPR A . n A 1 213 SER 213 193 193 SER SER A . n A 1 214 VAL 214 194 194 VAL VAL A . n A 1 215 PRO 215 195 195 PRO PRO A . n A 1 216 GLU 216 196 196 GLU GLU A . n A 1 217 ALA 217 197 197 ALA ALA A . n A 1 218 ARG 218 198 198 ARG ARG A . n A 1 219 VAL 219 199 199 VAL VAL A . n A 1 220 LEU 220 200 200 LEU LEU A . n A 1 221 ASP 221 201 201 ASP ASP A . n A 1 222 THR 222 202 202 THR THR A . n A 1 223 LEU 223 203 203 LEU LEU A . n A 1 224 VAL 224 204 204 VAL VAL A . n A 1 225 HIS 225 205 205 HIS HIS A . n A 1 226 ILE 226 206 206 ILE ILE A . n A 1 227 TRP 227 207 207 TRP TRP A . n A 1 228 VAL 228 208 208 VAL VAL A . n A 1 229 THR 229 209 209 THR THR A . n A 1 230 SER 230 210 210 SER SER A . n A 1 231 ILE 231 211 211 ILE ILE A . n A 1 232 TYR 232 212 212 TYR TYR A . n A 1 233 GLY 233 213 213 GLY GLY A . n A 1 234 GLU 234 214 214 GLU GLU A . n A 1 235 ASN 235 215 215 ASN ASN A . n A 1 236 ARG 236 216 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 105 A MSE 85 ? MET SELENOMETHIONINE 2 A MSE 122 A MSE 102 ? MET SELENOMETHIONINE 3 A MSE 162 A MSE 142 ? MET SELENOMETHIONINE 4 A MSE 198 A MSE 178 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 122.3800000000 -1.0000000000 0.0000000000 0.0000000000 122.3800000000 0.0000000000 0.0000000000 -1.0000000000 16.7850000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data scaling' . ? 1 XDS 'data reduction' . ? 2 SHARP phasing . ? 3 CNS refinement . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 1075 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 1075 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_664 _pdbx_validate_symm_contact.dist 1.88 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 62 ? ? -58.99 1.48 2 1 ASN A 93 ? ? -119.87 79.44 3 1 PRO A 94 ? ? -37.84 -115.71 4 1 ALA A 95 ? ? 159.63 116.96 5 1 ASP A 96 ? ? -63.39 91.47 6 1 HIS A 117 ? ? -145.67 53.41 7 1 THR A 165 ? ? -105.72 -103.68 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -19 ? A MSE 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A VAL 1 ? A VAL 21 22 1 Y 1 A THR 2 ? A THR 22 23 1 Y 1 A THR 3 ? A THR 23 24 1 Y 1 A SER 4 ? A SER 24 25 1 Y 1 A ALA 5 ? A ALA 25 26 1 Y 1 A ALA 6 ? A ALA 26 27 1 Y 1 A SER 7 ? A SER 27 28 1 Y 1 A GLN 8 ? A GLN 28 29 1 Y 1 A ALA 9 ? A ALA 29 30 1 Y 1 A SER 10 ? A SER 30 31 1 Y 1 A LEU 11 ? A LEU 31 32 1 Y 1 A PRO 12 ? A PRO 32 33 1 Y 1 A ARG 13 ? A ARG 33 34 1 Y 1 A GLY 14 ? A GLY 34 35 1 Y 1 A ARG 15 ? A ARG 35 36 1 Y 1 A ARG 16 ? A ARG 36 37 1 Y 1 A THR 17 ? A THR 37 38 1 Y 1 A ALA 18 ? A ALA 38 39 1 Y 1 A ARG 19 ? A ARG 39 40 1 Y 1 A PRO 20 ? A PRO 40 41 1 Y 1 A SER 21 ? A SER 41 42 1 Y 1 A ARG 216 ? A ARG 236 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEXADECYL OCTANOATE' CNS 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CNS 1 1001 1 CNS CNS A . C 3 HOH 1 1002 1 HOH TIP A . C 3 HOH 2 1003 2 HOH TIP A . C 3 HOH 3 1004 3 HOH TIP A . C 3 HOH 4 1005 5 HOH TIP A . C 3 HOH 5 1006 6 HOH TIP A . C 3 HOH 6 1007 7 HOH TIP A . C 3 HOH 7 1008 8 HOH TIP A . C 3 HOH 8 1009 9 HOH TIP A . C 3 HOH 9 1010 12 HOH TIP A . C 3 HOH 10 1011 15 HOH TIP A . C 3 HOH 11 1012 16 HOH TIP A . C 3 HOH 12 1013 17 HOH TIP A . C 3 HOH 13 1014 18 HOH TIP A . C 3 HOH 14 1015 19 HOH TIP A . C 3 HOH 15 1016 20 HOH TIP A . C 3 HOH 16 1017 21 HOH TIP A . C 3 HOH 17 1018 22 HOH TIP A . C 3 HOH 18 1019 23 HOH TIP A . C 3 HOH 19 1020 24 HOH TIP A . C 3 HOH 20 1021 25 HOH TIP A . C 3 HOH 21 1022 26 HOH TIP A . C 3 HOH 22 1023 27 HOH TIP A . C 3 HOH 23 1024 28 HOH TIP A . C 3 HOH 24 1025 29 HOH TIP A . C 3 HOH 25 1026 30 HOH TIP A . C 3 HOH 26 1027 31 HOH TIP A . C 3 HOH 27 1028 32 HOH TIP A . C 3 HOH 28 1029 33 HOH TIP A . C 3 HOH 29 1030 34 HOH TIP A . C 3 HOH 30 1031 35 HOH TIP A . C 3 HOH 31 1032 36 HOH TIP A . C 3 HOH 32 1033 37 HOH TIP A . C 3 HOH 33 1034 39 HOH TIP A . C 3 HOH 34 1035 40 HOH TIP A . C 3 HOH 35 1036 41 HOH TIP A . C 3 HOH 36 1037 42 HOH TIP A . C 3 HOH 37 1038 43 HOH TIP A . C 3 HOH 38 1039 44 HOH TIP A . C 3 HOH 39 1040 45 HOH TIP A . C 3 HOH 40 1041 46 HOH TIP A . C 3 HOH 41 1042 47 HOH TIP A . C 3 HOH 42 1043 48 HOH TIP A . C 3 HOH 43 1044 49 HOH TIP A . C 3 HOH 44 1045 51 HOH TIP A . C 3 HOH 45 1046 52 HOH TIP A . C 3 HOH 46 1047 53 HOH TIP A . C 3 HOH 47 1048 54 HOH TIP A . C 3 HOH 48 1049 55 HOH TIP A . C 3 HOH 49 1050 57 HOH TIP A . C 3 HOH 50 1051 58 HOH TIP A . C 3 HOH 51 1052 59 HOH TIP A . C 3 HOH 52 1053 60 HOH TIP A . C 3 HOH 53 1054 61 HOH TIP A . C 3 HOH 54 1055 62 HOH TIP A . C 3 HOH 55 1056 63 HOH TIP A . C 3 HOH 56 1057 64 HOH TIP A . C 3 HOH 57 1058 65 HOH TIP A . C 3 HOH 58 1059 66 HOH TIP A . C 3 HOH 59 1060 67 HOH TIP A . C 3 HOH 60 1061 68 HOH TIP A . C 3 HOH 61 1062 69 HOH TIP A . C 3 HOH 62 1063 70 HOH TIP A . C 3 HOH 63 1064 71 HOH TIP A . C 3 HOH 64 1065 73 HOH TIP A . C 3 HOH 65 1066 74 HOH TIP A . C 3 HOH 66 1067 75 HOH TIP A . C 3 HOH 67 1068 76 HOH TIP A . C 3 HOH 68 1069 77 HOH TIP A . C 3 HOH 69 1070 79 HOH TIP A . C 3 HOH 70 1071 80 HOH TIP A . C 3 HOH 71 1072 81 HOH TIP A . C 3 HOH 72 1073 82 HOH TIP A . C 3 HOH 73 1074 83 HOH TIP A . C 3 HOH 74 1075 84 HOH TIP A . C 3 HOH 75 1076 85 HOH TIP A . C 3 HOH 76 1077 86 HOH TIP A . C 3 HOH 77 1078 87 HOH TIP A . C 3 HOH 78 1079 88 HOH TIP A . C 3 HOH 79 1080 89 HOH TIP A . C 3 HOH 80 1081 90 HOH TIP A . C 3 HOH 81 1082 91 HOH TIP A . C 3 HOH 82 1083 92 HOH TIP A . C 3 HOH 83 1084 93 HOH TIP A . C 3 HOH 84 1085 94 HOH TIP A . C 3 HOH 85 1086 95 HOH TIP A . C 3 HOH 86 1087 96 HOH TIP A . C 3 HOH 87 1088 97 HOH TIP A . C 3 HOH 88 1089 98 HOH TIP A . C 3 HOH 89 1090 99 HOH TIP A . C 3 HOH 90 1091 100 HOH TIP A . C 3 HOH 91 1092 101 HOH TIP A . C 3 HOH 92 1093 102 HOH TIP A . C 3 HOH 93 1094 103 HOH TIP A . C 3 HOH 94 1095 104 HOH TIP A . C 3 HOH 95 1096 105 HOH TIP A . C 3 HOH 96 1097 106 HOH TIP A . C 3 HOH 97 1098 107 HOH TIP A . C 3 HOH 98 1099 108 HOH TIP A . C 3 HOH 99 1100 109 HOH TIP A . C 3 HOH 100 1101 110 HOH TIP A . C 3 HOH 101 1102 111 HOH TIP A . C 3 HOH 102 1103 112 HOH TIP A . C 3 HOH 103 1104 113 HOH TIP A . C 3 HOH 104 1105 114 HOH TIP A . C 3 HOH 105 1106 115 HOH TIP A . #