data_1UEG # _entry.id 1UEG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UEG RCSB RCSB005731 WWPDB D_1000005731 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1PA7 _pdbx_database_related.details 'The structure of the same protein at 1.45 A resolution' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UEG _pdbx_database_status.recvd_initial_deposition_date 2003-05-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hayashi, I.' 1 'Ikura, M.' 2 # _citation.id primary _citation.title 'Crystal structure of the amino-terminal microtubule-binding domain of end-binding protein 1 (EB1)' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 36430 _citation.page_last 36434 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12857735 _citation.pdbx_database_id_DOI 10.1074/jbc.M305773200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hayashi, I.' 1 primary 'Ikura, M.' 2 # _cell.entry_id 1UEG _cell.length_a 48.589 _cell.length_b 48.589 _cell.length_c 90.301 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UEG _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Microtubule-associated protein RP/EB family member 1' 15050.383 1 ? ? 'N-terminal domain, EB1 microtubule-binding domain' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'APC-binding protein EB1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQA GFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAAR ; _entity_poly.pdbx_seq_one_letter_code_can ;MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQA GFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAAR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 VAL n 1 4 ASN n 1 5 VAL n 1 6 TYR n 1 7 SER n 1 8 THR n 1 9 SER n 1 10 VAL n 1 11 THR n 1 12 SER n 1 13 ASP n 1 14 ASN n 1 15 LEU n 1 16 SER n 1 17 ARG n 1 18 HIS n 1 19 ASP n 1 20 MET n 1 21 LEU n 1 22 ALA n 1 23 TRP n 1 24 ILE n 1 25 ASN n 1 26 GLU n 1 27 SER n 1 28 LEU n 1 29 GLN n 1 30 LEU n 1 31 ASN n 1 32 LEU n 1 33 THR n 1 34 LYS n 1 35 ILE n 1 36 GLU n 1 37 GLN n 1 38 LEU n 1 39 CYS n 1 40 SER n 1 41 GLY n 1 42 ALA n 1 43 ALA n 1 44 TYR n 1 45 CYS n 1 46 GLN n 1 47 PHE n 1 48 MET n 1 49 ASP n 1 50 MET n 1 51 LEU n 1 52 PHE n 1 53 PRO n 1 54 GLY n 1 55 SER n 1 56 ILE n 1 57 ALA n 1 58 LEU n 1 59 LYS n 1 60 LYS n 1 61 VAL n 1 62 LYS n 1 63 PHE n 1 64 GLN n 1 65 ALA n 1 66 LYS n 1 67 LEU n 1 68 GLU n 1 69 HIS n 1 70 GLU n 1 71 TYR n 1 72 ILE n 1 73 GLN n 1 74 ASN n 1 75 PHE n 1 76 LYS n 1 77 ILE n 1 78 LEU n 1 79 GLN n 1 80 ALA n 1 81 GLY n 1 82 PHE n 1 83 LYS n 1 84 ARG n 1 85 MET n 1 86 GLY n 1 87 VAL n 1 88 ASP n 1 89 LYS n 1 90 ILE n 1 91 ILE n 1 92 PRO n 1 93 VAL n 1 94 ASP n 1 95 LYS n 1 96 LEU n 1 97 VAL n 1 98 LYS n 1 99 GLY n 1 100 LYS n 1 101 PHE n 1 102 GLN n 1 103 ASP n 1 104 ASN n 1 105 PHE n 1 106 GLU n 1 107 PHE n 1 108 VAL n 1 109 GLN n 1 110 TRP n 1 111 PHE n 1 112 LYS n 1 113 LYS n 1 114 PHE n 1 115 PHE n 1 116 ASP n 1 117 ALA n 1 118 ASN n 1 119 TYR n 1 120 ASP n 1 121 GLY n 1 122 LYS n 1 123 ASP n 1 124 TYR n 1 125 ASP n 1 126 PRO n 1 127 VAL n 1 128 ALA n 1 129 ALA n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'EB1 (amino acids 1-130)' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MARE1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQA GFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAAR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q15691 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UEG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15691 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1UEG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_percent_sol 33.64 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details 'ammonium sulfate, sodium citrate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2002-11-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9790 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X12C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X12C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9790 # _reflns.entry_id 1UEG _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.4 _reflns.number_obs 4615 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.109 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 22.2 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.47 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs 0.282 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1UEG _refine.ls_number_reflns_obs 4481 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 2188869.18 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 9.88 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 98.9 _refine.ls_R_factor_obs 0.223 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.223 _refine.ls_R_factor_R_free 0.279 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 11.2 _refine.ls_number_reflns_R_free 501 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 25.0 _refine.aniso_B[1][1] 3.24 _refine.aniso_B[2][2] 3.24 _refine.aniso_B[3][3] -6.48 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.415 _refine.solvent_model_param_bsol 65.6661 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1UEG _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_sigma_a_obs 0.19 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.37 _refine_analyze.Luzzati_sigma_a_free 0.30 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 975 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1019 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 9.88 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.016 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.12 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.23 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 1.99 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.22 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.23 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.40 _refine_ls_shell.d_res_low 2.55 _refine_ls_shell.number_reflns_R_work 632 _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.percent_reflns_obs 98.4 _refine_ls_shell.R_factor_R_free 0.304 _refine_ls_shell.R_factor_R_free_error 0.032 _refine_ls_shell.percent_reflns_R_free 12.5 _refine_ls_shell.number_reflns_R_free 90 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1UEG _struct.title 'Crystal structure of amino-terminal microtubule binding domain of EB1' _struct.pdbx_descriptor 'Microtubule-associated protein RP/EB family member 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UEG _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'CH domain, STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? GLN A 29 ? SER A 16 GLN A 29 1 ? 14 HELX_P HELX_P2 2 LYS A 34 ? SER A 40 ? LYS A 34 SER A 40 5 ? 7 HELX_P HELX_P3 3 GLY A 41 ? PHE A 52 ? GLY A 41 PHE A 52 1 ? 12 HELX_P HELX_P4 4 ALA A 57 ? VAL A 61 ? ALA A 57 VAL A 61 5 ? 5 HELX_P HELX_P5 5 LEU A 67 ? MET A 85 ? LEU A 67 MET A 85 1 ? 19 HELX_P HELX_P6 6 PRO A 92 ? VAL A 97 ? PRO A 92 VAL A 97 1 ? 6 HELX_P HELX_P7 7 LYS A 100 ? TYR A 119 ? LYS A 100 TYR A 119 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 131' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 SER A 16 ? SER A 16 . ? 1_555 ? 2 AC1 5 ARG A 17 ? ARG A 17 . ? 1_555 ? 3 AC1 5 HIS A 18 ? HIS A 18 . ? 1_555 ? 4 AC1 5 ARG A 130 ? ARG A 130 . ? 5_654 ? 5 AC1 5 HOH C . ? HOH A 165 . ? 1_555 ? # _database_PDB_matrix.entry_id 1UEG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UEG _atom_sites.fract_transf_matrix[1][1] 0.020581 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020581 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011074 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 VAL 10 10 ? ? ? A . n A 1 11 THR 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ASP 123 123 ? ? ? A . n A 1 124 TYR 124 124 ? ? ? A . n A 1 125 ASP 125 125 ? ? ? A . n A 1 126 PRO 126 126 ? ? ? A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ARG 130 130 130 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 131 40 SO4 SO4 A . C 3 HOH 1 132 1 HOH HOH A . C 3 HOH 2 133 2 HOH HOH A . C 3 HOH 3 134 3 HOH HOH A . C 3 HOH 4 135 4 HOH HOH A . C 3 HOH 5 136 5 HOH HOH A . C 3 HOH 6 137 6 HOH HOH A . C 3 HOH 7 138 7 HOH HOH A . C 3 HOH 8 139 8 HOH HOH A . C 3 HOH 9 140 9 HOH HOH A . C 3 HOH 10 141 10 HOH HOH A . C 3 HOH 11 142 11 HOH HOH A . C 3 HOH 12 143 12 HOH HOH A . C 3 HOH 13 144 13 HOH HOH A . C 3 HOH 14 145 14 HOH HOH A . C 3 HOH 15 146 15 HOH HOH A . C 3 HOH 16 147 16 HOH HOH A . C 3 HOH 17 148 17 HOH HOH A . C 3 HOH 18 149 18 HOH HOH A . C 3 HOH 19 150 19 HOH HOH A . C 3 HOH 20 151 20 HOH HOH A . C 3 HOH 21 152 21 HOH HOH A . C 3 HOH 22 153 22 HOH HOH A . C 3 HOH 23 154 23 HOH HOH A . C 3 HOH 24 155 24 HOH HOH A . C 3 HOH 25 156 25 HOH HOH A . C 3 HOH 26 157 26 HOH HOH A . C 3 HOH 27 158 27 HOH HOH A . C 3 HOH 28 159 28 HOH HOH A . C 3 HOH 29 160 29 HOH HOH A . C 3 HOH 30 161 30 HOH HOH A . C 3 HOH 31 162 31 HOH HOH A . C 3 HOH 32 163 32 HOH HOH A . C 3 HOH 33 164 33 HOH HOH A . C 3 HOH 34 165 34 HOH HOH A . C 3 HOH 35 166 35 HOH HOH A . C 3 HOH 36 167 36 HOH HOH A . C 3 HOH 37 168 37 HOH HOH A . C 3 HOH 38 169 38 HOH HOH A . C 3 HOH 39 170 39 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-10-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 84 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 98 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_444 _pdbx_validate_symm_contact.dist 1.97 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A LEU 96 ? ? N A VAL 97 ? ? 1.573 1.336 0.237 0.023 Y 2 1 CE A LYS 98 ? ? NZ A LYS 98 ? ? 1.142 1.486 -0.344 0.025 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 O A LEU 96 ? ? C A LEU 96 ? ? N A VAL 97 ? ? 133.78 122.70 11.08 1.60 Y 2 1 CD A LYS 98 ? ? CE A LYS 98 ? ? NZ A LYS 98 ? ? 140.36 111.70 28.66 2.30 N 3 1 CA A PHE 101 ? ? C A PHE 101 ? ? N A GLN 102 ? ? 131.81 117.20 14.61 2.20 Y 4 1 O A PHE 101 ? ? C A PHE 101 ? ? N A GLN 102 ? ? 107.92 122.70 -14.78 1.60 Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 120 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -136.80 _pdbx_validate_torsion.psi -42.36 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A SER 7 ? C ? A SER 7 C 2 1 Y 0 A ARG 17 ? CG ? A ARG 17 CG 3 1 Y 0 A ARG 17 ? CZ ? A ARG 17 CZ 4 1 Y 0 A ARG 17 ? NH1 ? A ARG 17 NH1 5 1 Y 0 A ARG 17 ? NH2 ? A ARG 17 NH2 6 1 Y 0 A LEU 21 ? CD1 ? A LEU 21 CD1 7 1 Y 0 A GLN 29 ? CG ? A GLN 29 CG 8 1 Y 0 A ASN 31 ? CB ? A ASN 31 CB 9 1 Y 0 A ASN 31 ? OD1 ? A ASN 31 OD1 10 1 Y 0 A ASN 31 ? ND2 ? A ASN 31 ND2 11 1 Y 0 A LEU 32 ? CD2 ? A LEU 32 CD2 12 1 Y 0 A LYS 34 ? CD ? A LYS 34 CD 13 1 Y 0 A LYS 34 ? CE ? A LYS 34 CE 14 1 Y 0 A PRO 53 ? CB ? A PRO 53 CB 15 1 Y 0 A LYS 59 ? CB ? A LYS 59 CB 16 1 Y 0 A LYS 59 ? CD ? A LYS 59 CD 17 1 Y 0 A LYS 59 ? CE ? A LYS 59 CE 18 1 Y 0 A LYS 59 ? NZ ? A LYS 59 NZ 19 1 Y 0 A LYS 60 ? CD ? A LYS 60 CD 20 1 Y 0 A LYS 60 ? CE ? A LYS 60 CE 21 1 Y 0 A LYS 62 ? NZ ? A LYS 62 NZ 22 1 Y 0 A GLN 73 ? OE1 ? A GLN 73 OE1 23 1 Y 0 A LYS 76 ? CD ? A LYS 76 CD 24 1 Y 0 A LYS 95 ? CD ? A LYS 95 CD 25 1 Y 0 A LYS 95 ? CE ? A LYS 95 CE 26 1 Y 0 A LYS 95 ? NZ ? A LYS 95 NZ 27 1 Y 0 A LYS 98 ? NZ ? A LYS 98 NZ 28 1 Y 0 A LYS 100 ? CE ? A LYS 100 CE 29 1 Y 0 A LYS 100 ? NZ ? A LYS 100 NZ 30 1 Y 0 A GLN 102 ? CG ? A GLN 102 CG 31 1 Y 0 A GLN 102 ? CD ? A GLN 102 CD 32 1 Y 0 A GLN 102 ? OE1 ? A GLN 102 OE1 33 1 Y 0 A GLN 102 ? NE2 ? A GLN 102 NE2 34 1 Y 0 A GLN 109 ? NE2 ? A GLN 109 NE2 35 1 Y 0 A GLY 121 ? CA ? A GLY 121 CA 36 1 Y 0 A LYS 122 ? CA ? A LYS 122 CA 37 1 Y 0 A LYS 122 ? C ? A LYS 122 C 38 1 Y 0 A LYS 122 ? CB ? A LYS 122 CB 39 1 Y 0 A ALA 128 ? CB ? A ALA 128 CB 40 1 N 0 A SO4 131 ? O1 ? B SO4 ? O1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 8 ? A THR 8 3 1 Y 1 A SER 9 ? A SER 9 4 1 Y 1 A VAL 10 ? A VAL 10 5 1 Y 1 A THR 11 ? A THR 11 6 1 Y 1 A SER 12 ? A SER 12 7 1 Y 1 A ASP 13 ? A ASP 13 8 1 Y 1 A ASP 123 ? A ASP 123 9 1 Y 1 A TYR 124 ? A TYR 124 10 1 Y 1 A ASP 125 ? A ASP 125 11 1 Y 1 A PRO 126 ? A PRO 126 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #