data_1UGV # _entry.id 1UGV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UGV pdb_00001ugv 10.2210/pdb1ugv/pdb RCSB RCSB005809 ? ? WWPDB D_1000005809 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UGV _pdbx_database_status.recvd_initial_deposition_date 2003-06-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk001000008.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Hayashi, F.' 2 'Shirouzu, M.' 3 'Terada, T.' 4 'Kigawa, T.' 5 'Inoue, M.' 6 'Yabuki, T.' 7 'Aoki, M.' 8 'Seki, E.' 9 'Matsuda, T.' 10 'Hirota, H.' 11 'Yoshida, M.' 12 'Tanaka, A.' 13 'Osanai, T.' 14 'Matsuo, Y.' 15 'Ohara, O.' 16 'Nagase, T.' 17 'Kikuno, R.' 18 'Nakayama, M.' 19 'Yokoyama, S.' 20 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 21 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of human olygophrein-1 like protein (KIAA0621)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Shirouzu, M.' 3 ? primary 'Terada, T.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Inoue, M.' 6 ? primary 'Yabuki, T.' 7 ? primary 'Aoki, M.' 8 ? primary 'Seki, E.' 9 ? primary 'Matsuda, T.' 10 ? primary 'Hirota, H.' 11 ? primary 'Yoshida, M.' 12 ? primary 'Tanaka, A.' 13 ? primary 'Osanai, T.' 14 ? primary 'Matsuo, Y.' 15 ? primary 'Ohara, O.' 16 ? primary 'Nagase, T.' 17 ? primary 'Kikuno, R.' 18 ? primary 'Nakayama, M.' 19 ? primary 'Yokoyama, S.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Olygophrenin-1 like protein' _entity.formula_weight 7525.187 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name KIAA0621 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFLSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFLSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk001000008.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 PRO n 1 10 PHE n 1 11 ARG n 1 12 LYS n 1 13 ALA n 1 14 LYS n 1 15 ALA n 1 16 LEU n 1 17 TYR n 1 18 ALA n 1 19 CYS n 1 20 LYS n 1 21 ALA n 1 22 GLU n 1 23 HIS n 1 24 ASP n 1 25 SER n 1 26 GLU n 1 27 LEU n 1 28 SER n 1 29 PHE n 1 30 THR n 1 31 ALA n 1 32 GLY n 1 33 THR n 1 34 VAL n 1 35 PHE n 1 36 ASP n 1 37 ASN n 1 38 VAL n 1 39 HIS n 1 40 PRO n 1 41 SER n 1 42 GLN n 1 43 GLU n 1 44 PRO n 1 45 GLY n 1 46 TRP n 1 47 LEU n 1 48 GLU n 1 49 GLY n 1 50 THR n 1 51 LEU n 1 52 ASN n 1 53 GLY n 1 54 LYS n 1 55 THR n 1 56 GLY n 1 57 LEU n 1 58 ILE n 1 59 PRO n 1 60 GLU n 1 61 ASN n 1 62 TYR n 1 63 VAL n 1 64 GLU n 1 65 PHE n 1 66 LEU n 1 67 SER n 1 68 GLY n 1 69 PRO n 1 70 SER n 1 71 SER n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'Kazusa cDNA hg04539' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P021021-18 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n # _cell.entry_id 1UGV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UGV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1UGV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1UGV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1UGV _struct.title 'Solution structure of the SH3 domain of human olygophrein-1 like protein (KIAA0621)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UGV _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'BETA BARREL, Graf Protein, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RHG26_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL _struct_ref.pdbx_align_begin 756 _struct_ref.pdbx_db_accession Q9UNA1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UGV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UNA1 _struct_ref_seq.db_align_beg 756 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 814 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1UGV GLY A 1 ? UNP Q9UNA1 ? ? 'cloning artifact' 1 1 1 1UGV SER A 2 ? UNP Q9UNA1 ? ? 'cloning artifact' 2 2 1 1UGV SER A 3 ? UNP Q9UNA1 ? ? 'cloning artifact' 3 3 1 1UGV GLY A 4 ? UNP Q9UNA1 ? ? 'cloning artifact' 4 4 1 1UGV SER A 5 ? UNP Q9UNA1 ? ? 'cloning artifact' 5 5 1 1UGV SER A 6 ? UNP Q9UNA1 ? ? 'cloning artifact' 6 6 1 1UGV GLY A 7 ? UNP Q9UNA1 ? ? 'cloning artifact' 7 7 1 1UGV SER A 67 ? UNP Q9UNA1 ? ? 'cloning artifact' 67 8 1 1UGV GLY A 68 ? UNP Q9UNA1 ? ? 'cloning artifact' 68 9 1 1UGV PRO A 69 ? UNP Q9UNA1 ? ? 'cloning artifact' 69 10 1 1UGV SER A 70 ? UNP Q9UNA1 ? ? 'cloning artifact' 70 11 1 1UGV SER A 71 ? UNP Q9UNA1 ? ? 'cloning artifact' 71 12 1 1UGV GLY A 72 ? UNP Q9UNA1 ? ? 'cloning artifact' 72 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 34 ? PHE A 35 ? VAL A 34 PHE A 35 A 2 ALA A 13 ? ALA A 15 ? ALA A 13 ALA A 15 A 3 VAL A 63 ? PHE A 65 ? VAL A 63 PHE A 65 B 1 TRP A 46 ? THR A 50 ? TRP A 46 THR A 50 B 2 THR A 55 ? PRO A 59 ? THR A 55 PRO A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 35 ? O PHE A 35 N ALA A 13 ? N ALA A 13 A 2 3 N LYS A 14 ? N LYS A 14 O GLU A 64 ? O GLU A 64 B 1 2 N LEU A 47 ? N LEU A 47 O ILE A 58 ? O ILE A 58 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ALA 15 ? ? H A GLY 32 ? ? 1.58 2 1 O A HIS 39 ? ? H A GLU 48 ? ? 1.58 3 1 H A LEU 47 ? ? O A ILE 58 ? ? 1.59 4 2 O A HIS 39 ? ? H A GLU 48 ? ? 1.54 5 2 HG1 A THR 50 ? ? OG1 A THR 55 ? ? 1.56 6 2 O A ALA 13 ? ? H A PHE 35 ? ? 1.57 7 3 H A LEU 47 ? ? O A ILE 58 ? ? 1.53 8 4 O A HIS 39 ? ? H A GLU 48 ? ? 1.58 9 5 O A HIS 39 ? ? H A GLU 48 ? ? 1.51 10 5 O A ALA 13 ? ? H A PHE 35 ? ? 1.56 11 6 O A HIS 39 ? ? H A GLU 48 ? ? 1.52 12 6 H A LEU 47 ? ? O A ILE 58 ? ? 1.55 13 7 O A HIS 39 ? ? H A GLU 48 ? ? 1.51 14 7 H A LEU 47 ? ? O A ILE 58 ? ? 1.58 15 7 O A ALA 13 ? ? H A PHE 35 ? ? 1.59 16 8 O A HIS 39 ? ? H A GLU 48 ? ? 1.48 17 8 H A LEU 47 ? ? O A ILE 58 ? ? 1.54 18 8 O A ALA 13 ? ? H A PHE 35 ? ? 1.59 19 9 O A HIS 39 ? ? H A GLU 48 ? ? 1.51 20 9 H A LEU 47 ? ? O A ILE 58 ? ? 1.59 21 10 O A HIS 39 ? ? H A GLU 48 ? ? 1.51 22 10 H A LEU 47 ? ? O A ILE 58 ? ? 1.53 23 10 O A ALA 13 ? ? H A PHE 35 ? ? 1.57 24 11 O A HIS 39 ? ? H A GLU 48 ? ? 1.50 25 11 H A LEU 47 ? ? O A ILE 58 ? ? 1.51 26 11 O A SER 25 ? ? H A LEU 57 ? ? 1.59 27 12 H A LEU 47 ? ? O A ILE 58 ? ? 1.58 28 12 O A HIS 39 ? ? H A GLU 48 ? ? 1.58 29 13 H A LEU 47 ? ? O A ILE 58 ? ? 1.50 30 13 O A HIS 39 ? ? H A GLU 48 ? ? 1.50 31 13 H A LEU 51 ? ? O A LYS 54 ? ? 1.53 32 14 O A HIS 39 ? ? H A GLU 48 ? ? 1.52 33 14 H A LEU 47 ? ? O A ILE 58 ? ? 1.60 34 15 H A LEU 47 ? ? O A ILE 58 ? ? 1.53 35 15 O A HIS 39 ? ? H A GLU 48 ? ? 1.55 36 15 H A LEU 16 ? ? O A TYR 62 ? ? 1.56 37 15 H A LEU 51 ? ? O A LYS 54 ? ? 1.57 38 16 O A HIS 39 ? ? H A GLU 48 ? ? 1.56 39 16 H A LEU 16 ? ? O A TYR 62 ? ? 1.56 40 17 H A LEU 47 ? ? O A ILE 58 ? ? 1.49 41 17 O A HIS 39 ? ? H A GLU 48 ? ? 1.50 42 17 H A LEU 16 ? ? O A TYR 62 ? ? 1.56 43 18 O A HIS 39 ? ? H A GLU 48 ? ? 1.49 44 18 H A LEU 47 ? ? O A ILE 58 ? ? 1.50 45 18 H A LEU 51 ? ? O A LYS 54 ? ? 1.56 46 19 O A HIS 39 ? ? H A GLU 48 ? ? 1.50 47 19 H A LEU 47 ? ? O A ILE 58 ? ? 1.56 48 19 O A LEU 47 ? ? H A ILE 58 ? ? 1.60 49 20 H A LEU 47 ? ? O A ILE 58 ? ? 1.47 50 20 O A HIS 39 ? ? H A GLU 48 ? ? 1.50 51 20 O A SER 25 ? ? H A LEU 57 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 66.44 96.42 2 1 PHE A 10 ? ? 56.96 179.08 3 1 LYS A 20 ? ? -106.61 64.54 4 1 ASN A 37 ? ? 40.24 79.79 5 1 ASN A 52 ? ? 59.66 74.89 6 1 SER A 67 ? ? -130.67 -55.42 7 1 SER A 70 ? ? -158.48 -58.23 8 1 SER A 71 ? ? 59.94 170.18 9 2 SER A 2 ? ? 41.10 81.43 10 2 SER A 5 ? ? 66.58 74.88 11 2 PHE A 10 ? ? 54.30 168.50 12 2 ALA A 21 ? ? -50.18 178.64 13 2 GLU A 22 ? ? 178.86 -35.71 14 2 SER A 25 ? ? -145.33 37.92 15 2 ASN A 37 ? ? 43.29 77.55 16 2 SER A 41 ? ? -59.78 -171.72 17 2 ASN A 52 ? ? 59.59 75.75 18 2 GLU A 64 ? ? -151.25 88.72 19 2 SER A 70 ? ? -51.51 109.22 20 3 SER A 2 ? ? -149.38 -58.42 21 3 SER A 5 ? ? 44.33 90.10 22 3 SER A 6 ? ? -143.04 -63.25 23 3 PHE A 10 ? ? 58.50 177.33 24 3 ALA A 21 ? ? -61.07 88.66 25 3 ASN A 37 ? ? 40.72 83.83 26 3 SER A 41 ? ? -64.92 -173.39 27 3 ASN A 52 ? ? 60.87 71.04 28 3 TYR A 62 ? ? -140.30 12.28 29 3 SER A 67 ? ? 59.60 167.11 30 4 ALA A 21 ? ? -52.88 178.95 31 4 GLU A 22 ? ? 176.24 -34.58 32 4 ASP A 24 ? ? 83.93 -64.86 33 4 ASN A 37 ? ? 41.02 85.82 34 4 SER A 41 ? ? -61.38 -178.07 35 4 ASN A 52 ? ? 61.31 76.38 36 4 TYR A 62 ? ? -141.64 15.90 37 4 GLU A 64 ? ? -154.90 86.32 38 4 PHE A 65 ? ? -38.97 131.33 39 4 LEU A 66 ? ? -91.32 -62.96 40 4 SER A 70 ? ? 57.21 90.09 41 5 SER A 3 ? ? -142.01 -56.12 42 5 SER A 5 ? ? -160.55 107.01 43 5 THR A 8 ? ? 61.54 163.07 44 5 PHE A 10 ? ? 57.97 162.38 45 5 ALA A 21 ? ? -50.60 178.28 46 5 GLU A 22 ? ? -166.81 -41.69 47 5 HIS A 23 ? ? -63.20 -86.25 48 5 ASP A 24 ? ? -179.41 -50.49 49 5 ASN A 37 ? ? 52.31 87.40 50 5 SER A 41 ? ? -62.00 -167.98 51 5 LEU A 51 ? ? -90.59 -66.68 52 5 ASN A 52 ? ? -143.24 55.38 53 5 TYR A 62 ? ? -141.01 12.58 54 5 GLU A 64 ? ? -154.39 88.26 55 5 SER A 67 ? ? 64.03 131.52 56 6 SER A 5 ? ? 64.39 161.62 57 6 LYS A 20 ? ? -110.38 78.78 58 6 ALA A 21 ? ? -48.70 175.43 59 6 GLU A 22 ? ? -156.50 -44.41 60 6 SER A 25 ? ? 179.21 -48.39 61 6 ASN A 37 ? ? 43.45 88.80 62 6 SER A 41 ? ? -58.42 -155.25 63 6 ASN A 52 ? ? 61.08 74.61 64 6 TYR A 62 ? ? -140.24 12.15 65 6 GLU A 64 ? ? -152.72 89.58 66 7 SER A 5 ? ? -176.36 114.30 67 7 PRO A 9 ? ? -74.95 -159.49 68 7 PHE A 10 ? ? -44.02 168.45 69 7 ALA A 21 ? ? 40.32 89.90 70 7 PHE A 29 ? ? -173.14 -178.25 71 7 ASN A 37 ? ? 61.89 86.01 72 7 SER A 41 ? ? -67.40 -178.99 73 7 GLU A 64 ? ? -152.44 86.80 74 7 PHE A 65 ? ? -38.56 135.28 75 7 SER A 67 ? ? 60.04 159.91 76 7 SER A 71 ? ? -175.55 -58.06 77 8 PHE A 10 ? ? 178.56 -177.61 78 8 ALA A 21 ? ? -45.72 169.38 79 8 GLU A 22 ? ? -146.52 -45.17 80 8 HIS A 23 ? ? -70.58 -81.08 81 8 ASP A 24 ? ? 176.56 -54.65 82 8 ASN A 37 ? ? 44.47 88.43 83 8 SER A 41 ? ? -56.36 -162.44 84 8 GLU A 64 ? ? -153.12 87.56 85 8 PHE A 65 ? ? -37.92 135.13 86 8 SER A 67 ? ? 173.99 137.20 87 8 SER A 70 ? ? -178.64 114.81 88 8 SER A 71 ? ? 53.47 91.48 89 9 THR A 8 ? ? 56.39 162.14 90 9 PHE A 10 ? ? 58.61 158.97 91 9 ALA A 21 ? ? -49.88 177.97 92 9 GLU A 22 ? ? -163.39 -43.12 93 9 SER A 25 ? ? 179.58 -48.67 94 9 ASN A 37 ? ? 40.02 84.47 95 9 SER A 41 ? ? -56.44 -161.84 96 9 ASN A 52 ? ? 60.34 75.77 97 9 TYR A 62 ? ? -141.80 15.00 98 10 SER A 5 ? ? 53.43 82.43 99 10 PRO A 9 ? ? -74.89 -159.97 100 10 PHE A 10 ? ? -44.98 170.60 101 10 ALA A 21 ? ? -50.27 178.88 102 10 GLU A 22 ? ? -171.47 -40.07 103 10 HIS A 23 ? ? -55.74 -79.95 104 10 ASP A 24 ? ? 168.15 -38.78 105 10 ASN A 37 ? ? 55.09 87.43 106 10 SER A 41 ? ? -66.96 -160.79 107 10 GLU A 64 ? ? -152.80 89.36 108 10 SER A 67 ? ? -138.31 -53.20 109 11 SER A 3 ? ? 58.15 88.90 110 11 PHE A 10 ? ? 56.16 -178.68 111 11 ALA A 21 ? ? -50.15 178.74 112 11 GLU A 22 ? ? -178.67 -36.94 113 11 HIS A 23 ? ? -62.56 -166.49 114 11 ASN A 37 ? ? 40.22 84.50 115 11 SER A 41 ? ? -59.40 -151.20 116 11 ASN A 52 ? ? 60.05 76.13 117 11 TYR A 62 ? ? -142.42 21.16 118 11 GLU A 64 ? ? -150.56 86.40 119 11 PHE A 65 ? ? -39.35 133.76 120 12 SER A 2 ? ? 44.78 85.14 121 12 THR A 8 ? ? 61.71 144.42 122 12 PRO A 9 ? ? -74.98 -159.38 123 12 HIS A 23 ? ? -117.61 -164.02 124 12 ASN A 37 ? ? 39.99 88.34 125 12 TYR A 62 ? ? -141.61 16.27 126 12 GLU A 64 ? ? -153.59 88.66 127 12 PHE A 65 ? ? -38.40 136.57 128 12 SER A 67 ? ? -178.90 147.54 129 12 SER A 70 ? ? 53.29 81.31 130 12 SER A 71 ? ? 59.82 86.14 131 13 SER A 2 ? ? 45.60 92.11 132 13 PRO A 9 ? ? -74.97 -159.32 133 13 ALA A 21 ? ? -49.47 177.23 134 13 GLU A 22 ? ? -164.41 -42.36 135 13 HIS A 23 ? ? -56.76 -83.68 136 13 ASP A 24 ? ? 176.60 -46.32 137 13 ASN A 37 ? ? 42.39 86.12 138 13 SER A 41 ? ? -56.37 -163.56 139 13 ASN A 52 ? ? 58.52 70.81 140 13 TYR A 62 ? ? -141.76 12.88 141 13 PHE A 65 ? ? -39.25 132.60 142 13 SER A 67 ? ? -100.05 -60.93 143 13 SER A 70 ? ? 52.56 174.58 144 14 PRO A 9 ? ? -74.98 -159.92 145 14 PHE A 10 ? ? -65.56 -177.98 146 14 HIS A 23 ? ? -143.00 -79.79 147 14 ASP A 24 ? ? 175.23 -57.49 148 14 ASN A 37 ? ? 39.84 88.03 149 14 SER A 41 ? ? -56.79 -161.81 150 14 ASN A 52 ? ? 61.08 73.00 151 14 SER A 70 ? ? 61.35 90.95 152 15 SER A 2 ? ? -131.42 -58.78 153 15 SER A 5 ? ? -67.31 73.87 154 15 PRO A 9 ? ? -75.00 -159.93 155 15 PHE A 10 ? ? -47.08 173.44 156 15 ALA A 21 ? ? -50.62 178.25 157 15 GLU A 22 ? ? -164.86 -42.38 158 15 HIS A 23 ? ? -75.40 -82.76 159 15 ASP A 24 ? ? 177.19 -49.59 160 15 ASN A 37 ? ? 42.30 89.11 161 15 SER A 41 ? ? -57.19 -161.33 162 15 ASN A 52 ? ? 60.08 64.68 163 15 GLU A 64 ? ? -153.90 89.94 164 15 PHE A 65 ? ? -38.62 137.25 165 15 SER A 67 ? ? -130.15 -62.44 166 15 SER A 70 ? ? 55.41 102.48 167 16 HIS A 23 ? ? -133.10 -74.95 168 16 ASP A 24 ? ? 170.29 -55.57 169 16 ASN A 37 ? ? 55.60 86.93 170 16 SER A 41 ? ? -60.24 -160.34 171 16 SER A 67 ? ? 69.25 -66.75 172 16 SER A 70 ? ? -163.78 -57.92 173 16 SER A 71 ? ? 49.02 85.53 174 17 SER A 2 ? ? 61.85 104.81 175 17 SER A 6 ? ? -170.12 -57.61 176 17 ALA A 21 ? ? -48.24 175.11 177 17 GLU A 22 ? ? -159.91 -43.13 178 17 SER A 25 ? ? 178.70 -48.44 179 17 ASN A 37 ? ? 45.06 79.96 180 17 SER A 41 ? ? -58.56 -165.16 181 17 ASN A 52 ? ? 56.81 70.54 182 17 SER A 70 ? ? 67.39 146.17 183 17 SER A 71 ? ? 63.20 84.07 184 18 SER A 3 ? ? -137.18 -59.70 185 18 SER A 6 ? ? -152.14 -53.03 186 18 PRO A 9 ? ? -74.97 -159.54 187 18 ALA A 21 ? ? -50.09 178.71 188 18 GLU A 22 ? ? -166.72 -40.91 189 18 HIS A 23 ? ? -62.28 -84.29 190 18 ASP A 24 ? ? 178.18 -50.99 191 18 ASN A 37 ? ? 44.82 87.44 192 18 SER A 41 ? ? -55.71 -72.39 193 18 GLN A 42 ? ? 177.95 -38.45 194 18 ASN A 52 ? ? 60.28 63.93 195 18 TYR A 62 ? ? -141.75 18.03 196 18 PHE A 65 ? ? -38.89 135.47 197 18 SER A 67 ? ? 59.11 156.98 198 18 SER A 70 ? ? 64.30 88.57 199 18 SER A 71 ? ? 63.42 127.54 200 19 SER A 2 ? ? -163.99 -56.44 201 19 SER A 3 ? ? 62.15 82.13 202 19 SER A 6 ? ? -141.85 -58.34 203 19 PHE A 10 ? ? 55.57 171.44 204 19 ALA A 21 ? ? -48.77 175.91 205 19 GLU A 22 ? ? -161.27 -42.96 206 19 HIS A 23 ? ? -56.78 -86.77 207 19 ASP A 24 ? ? 178.88 -53.18 208 19 GLU A 26 ? ? -51.10 171.02 209 19 THR A 33 ? ? -39.14 126.75 210 19 ASN A 37 ? ? 54.37 86.85 211 19 SER A 41 ? ? -57.51 -158.46 212 19 ASN A 52 ? ? 39.53 60.34 213 19 TYR A 62 ? ? -142.55 14.25 214 19 GLU A 64 ? ? -150.49 84.98 215 19 PHE A 65 ? ? -39.07 135.25 216 19 SER A 70 ? ? 59.07 109.04 217 20 SER A 2 ? ? 54.66 104.26 218 20 SER A 5 ? ? -148.08 -56.54 219 20 SER A 6 ? ? 65.39 163.92 220 20 PRO A 9 ? ? -74.99 -159.99 221 20 PHE A 10 ? ? -53.11 -175.73 222 20 SER A 25 ? ? -143.17 41.24 223 20 ASN A 37 ? ? 64.50 85.54 224 20 SER A 41 ? ? -53.81 -70.96 225 20 GLN A 42 ? ? 167.15 -31.59 226 20 LEU A 51 ? ? -129.34 -65.24 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1UGV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1UGV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2mM SH3 domain U-15N,13C; 20mM Tris buffer NA; 100mM NaCl; 1mM d10-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1UGV _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1C collection Varian 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.816 'data analysis' 'Kobayashi, N.' 4 CYANA 1.0.7 'structure solution' 'Guentert, P.' 5 CYANA 1.0.7 refinement 'Guentert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1UGV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_