data_1UHR # _entry.id 1UHR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UHR pdb_00001uhr 10.2210/pdb1uhr/pdb RCSB RCSB005841 ? ? WWPDB D_1000005841 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007019221.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UHR _pdbx_database_status.recvd_initial_deposition_date 2003-07-09 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yamada, K.' 1 'Saito, K.' 2 'Nameki, N.' 3 'Inoue, M.' 4 'Koshiba, S.' 5 'Shirouzu, M.' 6 'Terada, T.' 7 'Yabuki, T.' 8 'Aoki, M.' 9 'Matsuda, T.' 10 'Seki, E.' 11 'Hirota, H.' 12 'Yoshida, M.' 13 'Tanaka, A.' 14 'Osanai, T.' 15 'Arakawa, T.' 16 'Carninci, P.' 17 'Kawai, J.' 18 'Hayashizaki, Y.' 19 'Kigawa, T.' 20 'Yokoyama, S.' 21 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 22 # _citation.id primary _citation.title 'Solution structure of the SWIB domain of mouse BRG1-associated factor 60a' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yamada, K.' 1 ? primary 'Saito, K.' 2 ? primary 'Nameki, N.' 3 ? primary 'Inoue, M.' 4 ? primary 'Koshiba, S.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Terada, T.' 7 ? primary 'Yabuki, T.' 8 ? primary 'Aoki, M.' 9 ? primary 'Matsuda, T.' 10 ? primary 'Seki, E.' 11 ? primary 'Hirota, H.' 12 ? primary 'Yoshida, M.' 13 ? primary 'Tanaka, A.' 14 ? primary 'Osanai, T.' 15 ? primary 'Arakawa, T.' 16 ? primary 'Carninci, P.' 17 ? primary 'Kawai, J.' 18 ? primary 'Hayashizaki, Y.' 19 ? primary 'Kigawa, T.' 20 ? primary 'Yokoyama, S.' 21 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily D member 1' _entity.formula_weight 10634.217 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SWIB domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BRG1-associated factor 60a, BAF60A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVLCDKYLQQIFESQRMKFSEIPQRLHA LLMPPEPSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVLCDKYLQQIFESQRMKFSEIPQRLHA LLMPPEPSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007019221.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 PRO n 1 10 PRO n 1 11 GLN n 1 12 PHE n 1 13 LYS n 1 14 LEU n 1 15 ASP n 1 16 PRO n 1 17 ARG n 1 18 LEU n 1 19 ALA n 1 20 ARG n 1 21 LEU n 1 22 LEU n 1 23 GLY n 1 24 ILE n 1 25 HIS n 1 26 THR n 1 27 GLN n 1 28 THR n 1 29 ARG n 1 30 PRO n 1 31 VAL n 1 32 ILE n 1 33 ILE n 1 34 GLN n 1 35 ALA n 1 36 LEU n 1 37 TRP n 1 38 GLN n 1 39 TYR n 1 40 ILE n 1 41 LYS n 1 42 THR n 1 43 HIS n 1 44 LYS n 1 45 LEU n 1 46 GLN n 1 47 ASP n 1 48 PRO n 1 49 HIS n 1 50 GLU n 1 51 ARG n 1 52 GLU n 1 53 PHE n 1 54 VAL n 1 55 LEU n 1 56 CYS n 1 57 ASP n 1 58 LYS n 1 59 TYR n 1 60 LEU n 1 61 GLN n 1 62 GLN n 1 63 ILE n 1 64 PHE n 1 65 GLU n 1 66 SER n 1 67 GLN n 1 68 ARG n 1 69 MET n 1 70 LYS n 1 71 PHE n 1 72 SER n 1 73 GLU n 1 74 ILE n 1 75 PRO n 1 76 GLN n 1 77 ARG n 1 78 LEU n 1 79 HIS n 1 80 ALA n 1 81 LEU n 1 82 LEU n 1 83 MET n 1 84 PRO n 1 85 PRO n 1 86 GLU n 1 87 PRO n 1 88 SER n 1 89 GLY n 1 90 PRO n 1 91 SER n 1 92 SER n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 0710008A09' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P020826-29 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SMRD1_MOUSE _struct_ref.pdbx_db_accession Q61466 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVLCDKYLQQIFESQRMKFSEIPQRLHALLMPPEP ; _struct_ref.pdbx_align_begin 252 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UHR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q61466 _struct_ref_seq.db_align_beg 252 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 331 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1UHR GLY A 1 ? UNP Q61466 ? ? 'cloning artifact' 1 1 1 1UHR SER A 2 ? UNP Q61466 ? ? 'cloning artifact' 2 2 1 1UHR SER A 3 ? UNP Q61466 ? ? 'cloning artifact' 3 3 1 1UHR GLY A 4 ? UNP Q61466 ? ? 'cloning artifact' 4 4 1 1UHR SER A 5 ? UNP Q61466 ? ? 'cloning artifact' 5 5 1 1UHR SER A 6 ? UNP Q61466 ? ? 'cloning artifact' 6 6 1 1UHR GLY A 7 ? UNP Q61466 ? ? 'cloning artifact' 7 7 1 1UHR SER A 88 ? UNP Q61466 ? ? 'cloning artifact' 88 8 1 1UHR GLY A 89 ? UNP Q61466 ? ? 'cloning artifact' 89 9 1 1UHR PRO A 90 ? UNP Q61466 ? ? 'cloning artifact' 90 10 1 1UHR SER A 91 ? UNP Q61466 ? ? 'cloning artifact' 91 11 1 1UHR SER A 92 ? UNP Q61466 ? ? 'cloning artifact' 92 12 1 1UHR GLY A 93 ? UNP Q61466 ? ? 'cloning artifact' 93 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM Sodium Phosphate buffer (pH6.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_ensemble.entry_id 1UHR _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1UHR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5 'data analysis' 'Johnson, B. A.' 3 CYANA 1 'structure solution' 'Guentart, P.' 4 KUJIRA 0.706 'data analysis' 'Kobayashi, N.' 5 CYANA 1 refinement 'Guentart, P.' 6 # _exptl.entry_id 1UHR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1UHR _struct.title 'Solution structure of the SWIB domain of mouse BRG1-associated factor 60a' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UHR _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'structural genomics, SWI/SNF, Chromatin remodeling, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 17 ? LEU A 22 ? ARG A 17 LEU A 22 1 ? 6 HELX_P HELX_P2 2 ARG A 29 ? HIS A 43 ? ARG A 29 HIS A 43 1 ? 15 HELX_P HELX_P3 3 TYR A 59 ? PHE A 64 ? TYR A 59 PHE A 64 1 ? 6 HELX_P HELX_P4 4 ILE A 74 ? LEU A 81 ? ILE A 74 LEU A 81 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 26 ? GLN A 27 ? THR A 26 GLN A 27 A 2 PHE A 12 ? LEU A 14 ? PHE A 12 LEU A 14 A 3 LEU A 82 ? MET A 83 ? LEU A 82 MET A 83 B 1 PHE A 53 ? LEU A 55 ? PHE A 53 LEU A 55 B 2 ARG A 68 ? LYS A 70 ? ARG A 68 LYS A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 27 ? O GLN A 27 N PHE A 12 ? N PHE A 12 A 2 3 N LYS A 13 ? N LYS A 13 O MET A 83 ? O MET A 83 B 1 2 N VAL A 54 ? N VAL A 54 O MET A 69 ? O MET A 69 # _database_PDB_matrix.entry_id 1UHR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UHR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-24 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 57 ? ? H A GLN 61 ? ? 1.50 2 1 H A LYS 13 ? ? O A MET 83 ? ? 1.53 3 1 O A TYR 39 ? ? H A HIS 43 ? ? 1.55 4 1 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.57 5 1 O A LYS 70 ? ? H A GLU 73 ? ? 1.59 6 2 O A TYR 39 ? ? H A HIS 43 ? ? 1.56 7 2 O A LYS 70 ? ? H A GLU 73 ? ? 1.56 8 2 O A ASP 57 ? ? H A GLN 61 ? ? 1.56 9 2 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.58 10 3 OD1 A ASP 57 ? ? H A LEU 60 ? ? 1.50 11 3 O A ASP 57 ? ? H A GLN 61 ? ? 1.52 12 3 O A TYR 39 ? ? H A HIS 43 ? ? 1.53 13 3 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.57 14 4 O A ASP 57 ? ? H A GLN 61 ? ? 1.50 15 4 O A TYR 39 ? ? H A HIS 43 ? ? 1.55 16 4 O A LYS 70 ? ? H A GLU 73 ? ? 1.57 17 4 H A LYS 13 ? ? O A MET 83 ? ? 1.58 18 5 O A ASP 57 ? ? H A GLN 61 ? ? 1.51 19 5 O A LYS 70 ? ? H A GLU 73 ? ? 1.54 20 5 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.58 21 5 O A TYR 39 ? ? H A HIS 43 ? ? 1.59 22 6 O A ASP 57 ? ? H A GLN 61 ? ? 1.51 23 6 O A TYR 39 ? ? H A HIS 43 ? ? 1.52 24 6 H A LYS 13 ? ? O A MET 83 ? ? 1.53 25 6 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.57 26 6 O A LYS 70 ? ? H A GLU 73 ? ? 1.59 27 6 H A LEU 14 ? ? O A HIS 25 ? ? 1.60 28 7 OD1 A ASP 47 ? ? H A HIS 49 ? ? 1.48 29 7 O A GLU 52 ? ? H A PHE 71 ? ? 1.53 30 7 O A ASP 57 ? ? H A GLN 61 ? ? 1.54 31 7 O A LYS 70 ? ? H A GLU 73 ? ? 1.55 32 7 O A TYR 39 ? ? H A HIS 43 ? ? 1.55 33 7 O A LEU 60 ? ? H A PHE 64 ? ? 1.59 34 8 O A LYS 70 ? ? H A GLU 73 ? ? 1.54 35 8 O A TYR 39 ? ? H A HIS 43 ? ? 1.56 36 8 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.57 37 8 O A ASP 57 ? ? H A GLN 61 ? ? 1.57 38 8 O A GLU 52 ? ? H A PHE 71 ? ? 1.57 39 9 O A ASP 57 ? ? H A GLN 61 ? ? 1.52 40 9 H A LYS 13 ? ? O A MET 83 ? ? 1.55 41 9 O A LYS 70 ? ? H A GLU 73 ? ? 1.56 42 9 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.56 43 9 O A TYR 39 ? ? H A HIS 43 ? ? 1.56 44 9 O A GLU 52 ? ? H A PHE 71 ? ? 1.57 45 9 O A LEU 36 ? ? H A TYR 39 ? ? 1.59 46 10 O A ASP 57 ? ? H A GLN 61 ? ? 1.49 47 10 OD1 A ASP 57 ? ? H A LEU 60 ? ? 1.51 48 10 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.54 49 10 O A LYS 70 ? ? H A GLU 73 ? ? 1.54 50 10 O A TYR 39 ? ? H A HIS 43 ? ? 1.56 51 11 O A LYS 70 ? ? H A GLU 73 ? ? 1.53 52 11 O A ASP 57 ? ? H A GLN 61 ? ? 1.55 53 11 O A TYR 39 ? ? H A HIS 43 ? ? 1.56 54 12 OD1 A ASP 57 ? ? H A LEU 60 ? ? 1.50 55 12 O A TYR 39 ? ? H A HIS 43 ? ? 1.54 56 12 O A LYS 70 ? ? H A GLU 73 ? ? 1.55 57 12 O A ASP 57 ? ? H A GLN 61 ? ? 1.57 58 12 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.58 59 13 OD1 A ASP 57 ? ? H A LEU 60 ? ? 1.50 60 13 O A GLU 52 ? ? H A PHE 71 ? ? 1.53 61 13 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.55 62 13 O A TYR 39 ? ? H A HIS 43 ? ? 1.55 63 13 O A LYS 70 ? ? H A GLU 73 ? ? 1.55 64 13 H A LYS 13 ? ? O A MET 83 ? ? 1.59 65 13 O A ASP 57 ? ? H A GLN 61 ? ? 1.59 66 14 H A LYS 13 ? ? O A MET 83 ? ? 1.50 67 14 O A ASP 57 ? ? H A GLN 61 ? ? 1.52 68 15 O A LYS 70 ? ? H A GLU 73 ? ? 1.55 69 15 O A ASP 57 ? ? H A GLN 61 ? ? 1.56 70 15 O A TYR 39 ? ? H A HIS 43 ? ? 1.58 71 15 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.59 72 16 O A ASP 57 ? ? H A GLN 61 ? ? 1.49 73 16 O A TYR 39 ? ? H A HIS 43 ? ? 1.55 74 16 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.56 75 16 O A LYS 70 ? ? H A GLU 73 ? ? 1.60 76 17 H A LYS 13 ? ? O A MET 83 ? ? 1.51 77 17 O A ASP 57 ? ? H A GLN 61 ? ? 1.52 78 17 O A LYS 70 ? ? H A GLU 73 ? ? 1.55 79 17 O A TYR 39 ? ? H A HIS 43 ? ? 1.57 80 17 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.57 81 18 OD1 A ASP 47 ? ? H A HIS 49 ? ? 1.47 82 18 OD1 A ASP 57 ? ? H A LEU 60 ? ? 1.52 83 18 H A LYS 13 ? ? O A MET 83 ? ? 1.55 84 18 O A TYR 39 ? ? H A HIS 43 ? ? 1.57 85 19 O A ASP 57 ? ? H A GLN 61 ? ? 1.51 86 19 O A TYR 39 ? ? H A HIS 43 ? ? 1.55 87 19 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.56 88 19 O A LYS 70 ? ? H A GLU 73 ? ? 1.57 89 19 O A GLU 52 ? ? H A PHE 71 ? ? 1.59 90 20 O A ASP 57 ? ? H A GLN 61 ? ? 1.51 91 20 O A TYR 39 ? ? H A HIS 43 ? ? 1.54 92 20 OD2 A ASP 47 ? ? H A GLU 50 ? ? 1.58 93 20 O A LYS 70 ? ? H A GLU 73 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -166.25 110.28 2 1 SER A 5 ? ? -167.07 103.26 3 1 SER A 6 ? ? 56.75 95.88 4 1 GLN A 8 ? ? -39.95 143.07 5 1 LYS A 44 ? ? 39.66 58.09 6 1 PRO A 87 ? ? -74.99 -162.20 7 1 SER A 88 ? ? -171.57 -40.48 8 1 SER A 91 ? ? 65.03 98.64 9 2 SER A 3 ? ? -174.95 104.15 10 2 SER A 5 ? ? 42.30 89.82 11 2 SER A 6 ? ? -177.95 -56.29 12 2 GLN A 8 ? ? 39.69 86.69 13 2 LYS A 44 ? ? 38.85 60.06 14 2 SER A 92 ? ? 56.36 104.14 15 3 SER A 5 ? ? 62.64 116.49 16 3 SER A 6 ? ? 177.70 143.31 17 3 GLN A 11 ? ? -164.28 118.10 18 3 GLN A 27 ? ? -129.63 -167.59 19 3 SER A 88 ? ? 67.74 102.39 20 4 SER A 2 ? ? -171.54 -58.39 21 4 GLN A 11 ? ? -164.18 110.27 22 4 ALA A 19 ? ? -39.37 -32.35 23 4 LYS A 44 ? ? 38.86 59.11 24 4 GLU A 65 ? ? 70.22 30.25 25 4 PRO A 87 ? ? -75.01 -162.25 26 4 SER A 88 ? ? 50.21 81.19 27 4 SER A 91 ? ? -135.81 -59.21 28 4 SER A 92 ? ? 53.11 94.91 29 5 SER A 2 ? ? -164.84 -58.61 30 5 SER A 5 ? ? 51.11 98.86 31 5 GLN A 11 ? ? -165.93 109.37 32 5 LYS A 44 ? ? 39.65 58.97 33 5 ILE A 63 ? ? -102.00 -62.49 34 6 LYS A 44 ? ? 39.59 59.39 35 6 SER A 91 ? ? -168.92 -57.59 36 6 SER A 92 ? ? -96.52 -64.86 37 7 SER A 3 ? ? 61.87 125.70 38 7 SER A 5 ? ? 63.94 144.67 39 7 GLN A 8 ? ? -44.89 150.65 40 7 GLN A 11 ? ? -162.19 111.46 41 7 GLU A 65 ? ? 70.28 30.74 42 7 PRO A 87 ? ? -75.05 -162.20 43 7 SER A 88 ? ? 58.53 75.10 44 8 SER A 3 ? ? 64.65 163.29 45 8 SER A 6 ? ? -169.35 112.79 46 8 ALA A 19 ? ? -39.86 -31.59 47 8 LYS A 44 ? ? 39.51 59.94 48 8 ILE A 63 ? ? -101.71 -64.38 49 8 PRO A 85 ? ? -74.97 -166.58 50 9 SER A 3 ? ? 62.37 99.48 51 9 GLN A 8 ? ? 40.17 81.85 52 9 LYS A 44 ? ? 38.80 58.61 53 9 ASP A 57 ? ? -62.49 -178.82 54 9 ILE A 63 ? ? -102.22 -60.10 55 9 PRO A 87 ? ? -74.98 -162.29 56 9 SER A 88 ? ? 53.96 84.47 57 10 SER A 5 ? ? 179.27 160.86 58 10 SER A 6 ? ? -157.83 -54.51 59 10 GLN A 11 ? ? -162.59 116.59 60 10 ALA A 19 ? ? -39.97 -30.26 61 10 ALA A 35 ? ? -39.43 -30.75 62 10 ILE A 63 ? ? -101.75 -63.02 63 10 HIS A 79 ? ? -39.96 -37.54 64 10 PRO A 87 ? ? -75.05 -162.29 65 10 SER A 88 ? ? 50.29 77.68 66 10 SER A 91 ? ? 65.99 160.86 67 10 SER A 92 ? ? 47.90 93.80 68 11 SER A 2 ? ? 53.52 92.58 69 11 SER A 5 ? ? -128.40 -60.29 70 11 GLN A 8 ? ? 43.57 91.68 71 11 LYS A 44 ? ? 39.62 59.53 72 11 PRO A 87 ? ? -74.96 -162.25 73 11 SER A 88 ? ? 83.72 -49.65 74 12 SER A 6 ? ? -176.02 131.08 75 12 ALA A 19 ? ? -39.94 -30.74 76 12 ILE A 63 ? ? -101.67 -60.06 77 12 GLU A 65 ? ? 70.81 30.24 78 12 SER A 92 ? ? 45.77 84.15 79 13 GLN A 8 ? ? -44.28 153.19 80 13 GLN A 11 ? ? -166.69 113.22 81 13 ALA A 19 ? ? -39.91 -30.31 82 13 ALA A 35 ? ? -39.75 -30.16 83 13 ASP A 57 ? ? -63.25 -178.50 84 13 PRO A 87 ? ? -75.01 40.03 85 13 SER A 88 ? ? -161.22 108.84 86 14 SER A 2 ? ? -156.81 -61.14 87 14 SER A 5 ? ? -176.84 130.30 88 14 SER A 6 ? ? 50.40 86.78 89 14 ALA A 19 ? ? -39.31 -31.11 90 14 HIS A 25 ? ? -90.42 -64.37 91 14 GLN A 27 ? ? -175.15 -166.97 92 14 PRO A 87 ? ? -74.99 -162.25 93 14 SER A 88 ? ? 46.07 85.81 94 14 SER A 91 ? ? -40.79 105.87 95 15 GLN A 11 ? ? -165.37 111.98 96 15 ALA A 19 ? ? -38.49 -35.01 97 15 GLN A 27 ? ? -175.44 -177.93 98 15 ALA A 35 ? ? -39.87 -30.20 99 15 ILE A 63 ? ? -102.10 -61.98 100 15 PRO A 85 ? ? -75.05 -162.58 101 15 PRO A 87 ? ? -74.96 -162.26 102 16 SER A 2 ? ? 62.68 136.91 103 16 SER A 5 ? ? -128.19 -62.60 104 16 SER A 6 ? ? 47.74 92.48 105 16 ILE A 63 ? ? -101.94 -60.82 106 16 PRO A 87 ? ? -74.98 40.79 107 16 SER A 88 ? ? -172.05 120.72 108 16 SER A 91 ? ? 44.79 85.73 109 17 SER A 3 ? ? 62.81 159.55 110 17 LYS A 44 ? ? 39.46 60.82 111 17 ILE A 63 ? ? -101.87 -61.35 112 17 GLU A 65 ? ? 71.26 32.07 113 17 PRO A 87 ? ? -75.01 40.61 114 17 SER A 88 ? ? -176.27 86.84 115 18 ALA A 19 ? ? -39.48 -31.46 116 18 LYS A 44 ? ? 39.00 58.11 117 18 ASP A 57 ? ? -68.61 -169.41 118 18 PRO A 87 ? ? -75.01 -162.32 119 18 SER A 88 ? ? 50.00 89.71 120 19 SER A 2 ? ? 58.21 167.04 121 19 SER A 3 ? ? 179.63 148.57 122 19 GLN A 11 ? ? -160.96 107.66 123 19 ALA A 19 ? ? -39.95 -33.17 124 19 THR A 28 ? ? -67.90 -174.31 125 19 ALA A 35 ? ? -39.12 -30.31 126 19 SER A 91 ? ? -93.63 -70.83 127 19 SER A 92 ? ? 62.39 100.23 128 20 SER A 3 ? ? -164.32 -58.51 129 20 SER A 5 ? ? 178.45 124.99 130 20 GLN A 11 ? ? -161.76 115.52 131 20 ALA A 19 ? ? -39.12 -30.96 132 20 LYS A 44 ? ? 39.27 60.09 133 20 PRO A 87 ? ? -75.01 -162.12 134 20 SER A 88 ? ? 53.91 92.11 #