data_1UHZ # _entry.id 1UHZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UHZ pdb_00001uhz 10.2210/pdb1uhz/pdb RCSB RCSB005849 ? ? WWPDB D_1000005849 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-03 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UHZ _pdbx_database_status.recvd_initial_deposition_date 2003-07-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007013925.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Obayashi, N.' 3 'Shirouzu, M.' 4 'Terada, T.' 5 'Kigawa, T.' 6 'Inoue, M.' 7 'Yabuki, T.' 8 'Aoki, M.' 9 'Seki, E.' 10 'Matsuda, T.' 11 'Hirota, H.' 12 'Yoshida, M.' 13 'Koboyashi, N.' 14 'Tanaka, A.' 15 'Osanai, T.' 16 'Matsuo, Y.' 17 'Hayashizaki, Y.' 18 'Yokoyama, S.' 19 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 20 # _citation.id primary _citation.title 'Solution structure of dsRNA binding domain in Staufen homolog 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Obayashi, N.' 3 ? primary 'Shirouzu, M.' 4 ? primary 'Terada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Inoue, M.' 7 ? primary 'Yabuki, T.' 8 ? primary 'Aoki, M.' 9 ? primary 'Seki, E.' 10 ? primary 'Matsuda, T.' 11 ? primary 'Hirota, H.' 12 ? primary 'Yoshida, M.' 13 ? primary 'Koboyashi, N.' 14 ? primary 'Tanaka, A.' 15 ? primary 'Osanai, T.' 16 ? primary 'Matsuo, Y.' 17 ? primary 'Hayashizaki, Y.' 18 ? primary 'Yokoyama, S.' 19 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'staufen (RNA binding protein) homolog 2' _entity.formula_weight 9504.802 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'dsRNA binding domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'staufen homolog 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTS LQDSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTS LQDSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007013925.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 ILE n 1 10 SER n 1 11 ARG n 1 12 LEU n 1 13 ALA n 1 14 GLN n 1 15 ILE n 1 16 GLN n 1 17 GLN n 1 18 ALA n 1 19 ARG n 1 20 LYS n 1 21 GLU n 1 22 LYS n 1 23 GLU n 1 24 PRO n 1 25 ASP n 1 26 TYR n 1 27 ILE n 1 28 LEU n 1 29 LEU n 1 30 SER n 1 31 GLU n 1 32 ARG n 1 33 GLY n 1 34 MET n 1 35 PRO n 1 36 ARG n 1 37 ARG n 1 38 ARG n 1 39 GLU n 1 40 PHE n 1 41 VAL n 1 42 MET n 1 43 GLN n 1 44 VAL n 1 45 LYS n 1 46 VAL n 1 47 GLY n 1 48 ASN n 1 49 GLU n 1 50 VAL n 1 51 ALA n 1 52 THR n 1 53 GLY n 1 54 THR n 1 55 GLY n 1 56 PRO n 1 57 ASN n 1 58 LYS n 1 59 LYS n 1 60 ILE n 1 61 ALA n 1 62 LYS n 1 63 LYS n 1 64 ASN n 1 65 ALA n 1 66 ALA n 1 67 GLU n 1 68 ALA n 1 69 MET n 1 70 LEU n 1 71 LEU n 1 72 GLN n 1 73 LEU n 1 74 GLY n 1 75 TYR n 1 76 LYS n 1 77 ALA n 1 78 SER n 1 79 THR n 1 80 SER n 1 81 LEU n 1 82 GLN n 1 83 ASP n 1 84 SER n 1 85 GLY n 1 86 PRO n 1 87 SER n 1 88 SER n 1 89 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P021209-30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n # _cell.entry_id 1UHZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UHZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1UHZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1UHZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1UHZ _struct.title 'Solution structure of dsRNA binding domain in Staufen homolog 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UHZ _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'dsrm, Staufen homolog 2, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STAU2_MOUSE _struct_ref.pdbx_db_accession Q8CJ67 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTSLQDPLDK TG ; _struct_ref.pdbx_align_begin 3 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UHZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8CJ67 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1UHZ GLY A 1 ? UNP Q8CJ67 ? ? 'cloning artifact' 1 1 1 1UHZ SER A 2 ? UNP Q8CJ67 ? ? 'cloning artifact' 2 2 1 1UHZ SER A 3 ? UNP Q8CJ67 ? ? 'cloning artifact' 3 3 1 1UHZ GLY A 4 ? UNP Q8CJ67 ? ? 'cloning artifact' 4 4 1 1UHZ SER A 5 ? UNP Q8CJ67 ? ? 'cloning artifact' 5 5 1 1UHZ SER A 6 ? UNP Q8CJ67 ? ? 'cloning artifact' 6 6 1 1UHZ GLY A 7 ? UNP Q8CJ67 ? ? 'cloning artifact' 7 7 1 1UHZ SER A 84 ? UNP Q8CJ67 ? ? 'cloning artifact' 84 8 1 1UHZ GLY A 85 ? UNP Q8CJ67 ? ? 'cloning artifact' 85 9 1 1UHZ PRO A 86 ? UNP Q8CJ67 ? ? 'cloning artifact' 86 10 1 1UHZ SER A 87 ? UNP Q8CJ67 ? ? 'cloning artifact' 87 11 1 1UHZ SER A 88 ? UNP Q8CJ67 ? ? 'cloning artifact' 88 12 1 1UHZ GLY A 89 ? UNP Q8CJ67 ? ? 'cloning artifact' 89 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 8 ? ALA A 18 ? PRO A 8 ALA A 18 1 ? 11 HELX_P HELX_P2 2 LYS A 58 ? LEU A 73 ? LYS A 58 LEU A 73 1 ? 16 HELX_P HELX_P3 3 ALA A 77 ? SER A 84 ? ALA A 77 SER A 84 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 25 ? ARG A 32 ? ASP A 25 ARG A 32 A 2 GLU A 39 ? VAL A 46 ? GLU A 39 VAL A 46 A 3 GLU A 49 ? GLY A 55 ? GLU A 49 GLY A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 32 ? N ARG A 32 O GLU A 39 ? O GLU A 39 A 2 3 N VAL A 44 ? N VAL A 44 O ALA A 51 ? O ALA A 51 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ALA 68 ? ? H A GLN 72 ? ? 1.50 2 1 O A SER 10 ? ? H A GLN 14 ? ? 1.52 3 1 O A ILE 60 ? ? H A ASN 64 ? ? 1.57 4 2 O A SER 10 ? ? H A GLN 14 ? ? 1.52 5 2 O A ALA 66 ? ? H A LEU 70 ? ? 1.54 6 3 O A SER 10 ? ? H A GLN 14 ? ? 1.53 7 4 O A SER 10 ? ? H A GLN 14 ? ? 1.53 8 5 O A SER 10 ? ? H A GLN 14 ? ? 1.56 9 6 O A SER 10 ? ? H A GLN 14 ? ? 1.50 10 7 O A ILE 9 ? ? H A ALA 13 ? ? 1.58 11 7 O A ALA 68 ? ? H A GLN 72 ? ? 1.59 12 8 O A VAL 50 ? ? HE22 A GLN 72 ? ? 1.55 13 9 O A SER 10 ? ? H A GLN 14 ? ? 1.54 14 11 O A SER 10 ? ? H A GLN 14 ? ? 1.55 15 12 O A SER 10 ? ? H A GLN 14 ? ? 1.52 16 12 O A SER 30 ? ? H A VAL 41 ? ? 1.58 17 13 O A SER 10 ? ? H A GLN 14 ? ? 1.54 18 14 O A SER 10 ? ? H A GLN 14 ? ? 1.55 19 15 O A SER 10 ? ? H A GLN 14 ? ? 1.54 20 15 O A ALA 68 ? ? H A GLN 72 ? ? 1.60 21 16 O A LYS 58 ? ? H A LYS 62 ? ? 1.56 22 16 O A GLU 67 ? ? H A LEU 71 ? ? 1.56 23 17 O A SER 10 ? ? H A GLN 14 ? ? 1.54 24 18 O A SER 10 ? ? H A GLN 14 ? ? 1.55 25 19 O A SER 10 ? ? H A GLN 14 ? ? 1.47 26 19 O A ALA 68 ? ? H A GLN 72 ? ? 1.55 27 20 O A ALA 68 ? ? H A GLN 72 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 66.15 80.15 2 1 SER A 5 ? ? 59.22 165.55 3 1 GLU A 21 ? ? -99.29 -73.91 4 1 LYS A 22 ? ? 170.36 136.49 5 1 GLU A 23 ? ? -42.03 160.58 6 1 MET A 34 ? ? -47.22 156.90 7 1 LYS A 59 ? ? -40.26 -73.27 8 1 SER A 87 ? ? 42.86 81.77 9 2 SER A 2 ? ? 64.82 121.06 10 2 SER A 3 ? ? -67.43 98.31 11 2 SER A 5 ? ? -169.07 -67.40 12 2 GLU A 21 ? ? -96.25 -73.03 13 2 LYS A 22 ? ? 169.83 134.00 14 2 GLU A 23 ? ? -40.97 160.79 15 2 SER A 30 ? ? -175.99 -171.07 16 2 ARG A 38 ? ? 56.74 109.77 17 3 SER A 2 ? ? -170.79 80.45 18 3 SER A 3 ? ? -172.83 86.70 19 3 SER A 6 ? ? 62.22 155.16 20 3 ILE A 9 ? ? -65.12 -72.83 21 3 GLU A 21 ? ? -92.32 -76.74 22 3 LYS A 22 ? ? 172.45 136.13 23 3 GLU A 23 ? ? -42.32 159.22 24 3 ARG A 32 ? ? 179.14 -173.52 25 3 MET A 34 ? ? -46.20 158.55 26 3 LYS A 76 ? ? -140.09 22.98 27 3 SER A 87 ? ? 45.43 80.87 28 4 SER A 5 ? ? 64.48 163.11 29 4 SER A 6 ? ? -39.84 138.78 30 4 ILE A 9 ? ? -67.60 -73.87 31 4 GLU A 21 ? ? -92.04 -74.36 32 4 LYS A 22 ? ? 170.01 135.16 33 4 GLU A 23 ? ? -42.54 159.28 34 4 SER A 30 ? ? -166.62 -164.55 35 4 MET A 34 ? ? 63.85 154.51 36 4 ARG A 38 ? ? 57.46 103.94 37 5 SER A 3 ? ? 61.82 120.05 38 5 SER A 5 ? ? 53.02 83.77 39 5 ILE A 9 ? ? -65.59 -73.64 40 5 GLU A 21 ? ? -94.04 -73.59 41 5 LYS A 22 ? ? 163.61 138.86 42 5 GLU A 23 ? ? -37.91 156.62 43 5 MET A 34 ? ? -45.47 159.43 44 5 ARG A 37 ? ? -152.45 78.12 45 5 ARG A 38 ? ? -61.53 -179.24 46 5 LYS A 59 ? ? -40.76 -76.40 47 5 SER A 88 ? ? 176.81 78.97 48 6 SER A 2 ? ? -178.70 114.47 49 6 SER A 5 ? ? 56.69 104.72 50 6 SER A 6 ? ? 50.46 91.45 51 6 GLU A 21 ? ? -95.83 -75.09 52 6 LYS A 22 ? ? 172.28 136.85 53 6 GLU A 23 ? ? -42.73 160.72 54 6 ARG A 32 ? ? 179.24 155.04 55 6 MET A 34 ? ? 60.93 156.20 56 6 SER A 87 ? ? 65.56 153.35 57 6 SER A 88 ? ? 64.03 130.96 58 7 SER A 2 ? ? 58.24 93.90 59 7 SER A 5 ? ? 64.52 155.50 60 7 SER A 6 ? ? -44.14 105.81 61 7 ILE A 9 ? ? -67.61 -73.71 62 7 GLU A 21 ? ? -93.19 -69.71 63 7 LYS A 22 ? ? 164.24 132.19 64 7 GLU A 23 ? ? -39.55 159.53 65 7 MET A 34 ? ? -48.23 159.00 66 7 LYS A 59 ? ? -40.88 -76.58 67 7 SER A 87 ? ? 72.02 -65.03 68 7 SER A 88 ? ? 70.72 125.58 69 8 SER A 5 ? ? -164.66 99.73 70 8 SER A 6 ? ? -172.52 82.14 71 8 ILE A 9 ? ? -66.90 -73.84 72 8 GLU A 21 ? ? -101.79 -72.62 73 8 LYS A 22 ? ? 169.54 133.93 74 8 GLU A 23 ? ? -42.00 160.79 75 8 SER A 30 ? ? -171.30 -165.14 76 8 GLU A 31 ? ? -163.25 115.05 77 8 ARG A 38 ? ? -40.99 161.31 78 8 LYS A 59 ? ? -40.13 -75.94 79 8 SER A 87 ? ? -105.78 -60.59 80 9 SER A 2 ? ? -150.68 89.57 81 9 SER A 3 ? ? -171.42 145.71 82 9 SER A 6 ? ? 49.51 89.83 83 9 GLU A 21 ? ? -93.10 -74.41 84 9 LYS A 22 ? ? 170.21 135.40 85 9 GLU A 23 ? ? -41.63 159.79 86 9 SER A 30 ? ? -170.98 -176.58 87 9 ARG A 32 ? ? 178.71 158.57 88 9 MET A 34 ? ? -37.84 157.16 89 9 ARG A 38 ? ? 58.04 157.37 90 9 LYS A 59 ? ? -40.91 -76.40 91 10 SER A 3 ? ? -174.53 89.47 92 10 SER A 6 ? ? 43.07 88.58 93 10 ILE A 9 ? ? -68.54 -73.36 94 10 GLU A 21 ? ? -95.99 -71.40 95 10 LYS A 22 ? ? 166.19 132.06 96 10 GLU A 23 ? ? -39.84 160.53 97 10 SER A 30 ? ? -170.30 -168.70 98 10 ARG A 32 ? ? 178.80 179.86 99 10 MET A 34 ? ? -45.74 156.65 100 10 ARG A 38 ? ? 64.54 132.72 101 10 LYS A 59 ? ? -36.97 -78.09 102 10 SER A 87 ? ? -168.65 -58.89 103 11 SER A 5 ? ? 70.98 -68.49 104 11 ILE A 9 ? ? -68.83 -74.06 105 11 GLU A 21 ? ? -100.03 -72.41 106 11 LYS A 22 ? ? 169.84 133.97 107 11 GLU A 23 ? ? -42.56 159.64 108 11 ARG A 38 ? ? 44.88 96.08 109 11 LYS A 59 ? ? -45.84 -70.11 110 11 LYS A 76 ? ? -140.19 25.49 111 12 SER A 6 ? ? 61.73 91.80 112 12 GLU A 21 ? ? -91.31 -74.66 113 12 LYS A 22 ? ? 169.48 134.97 114 12 GLU A 23 ? ? -39.94 160.23 115 12 SER A 30 ? ? 176.61 -170.77 116 12 ARG A 32 ? ? 177.04 -54.01 117 12 SER A 88 ? ? -171.30 139.81 118 13 SER A 2 ? ? 61.17 87.42 119 13 SER A 3 ? ? -169.07 -58.15 120 13 SER A 5 ? ? 47.69 89.56 121 13 SER A 6 ? ? 177.70 152.27 122 13 ILE A 9 ? ? -68.95 -74.04 123 13 GLU A 21 ? ? -90.23 -78.75 124 13 LYS A 22 ? ? 174.84 131.47 125 13 GLU A 23 ? ? -38.93 158.36 126 13 LYS A 59 ? ? -42.50 -75.55 127 13 SER A 88 ? ? -176.97 119.89 128 14 SER A 5 ? ? 63.35 163.67 129 14 GLU A 21 ? ? -85.07 -80.75 130 14 LYS A 22 ? ? 176.88 132.85 131 14 GLU A 23 ? ? -39.13 157.50 132 14 MET A 34 ? ? -48.84 156.47 133 14 LYS A 59 ? ? -37.69 -76.86 134 14 LYS A 76 ? ? -149.62 24.34 135 15 SER A 2 ? ? -176.88 141.21 136 15 SER A 3 ? ? 179.93 145.42 137 15 ILE A 9 ? ? -67.09 -73.50 138 15 GLU A 21 ? ? -96.36 -75.55 139 15 LYS A 22 ? ? 173.07 135.10 140 15 GLU A 23 ? ? -43.70 160.38 141 15 SER A 30 ? ? -179.09 -170.74 142 15 ARG A 38 ? ? -48.25 168.64 143 15 LYS A 59 ? ? -43.15 -76.86 144 15 LYS A 76 ? ? -154.86 24.17 145 15 SER A 87 ? ? 59.00 98.72 146 15 SER A 88 ? ? -132.45 -57.62 147 16 SER A 3 ? ? -138.82 -60.15 148 16 SER A 6 ? ? 61.35 108.18 149 16 ILE A 9 ? ? -66.97 -73.95 150 16 GLU A 21 ? ? -94.35 -75.60 151 16 LYS A 22 ? ? 167.98 135.62 152 16 GLU A 23 ? ? -39.39 159.47 153 16 SER A 30 ? ? -171.43 -173.63 154 16 MET A 34 ? ? -41.55 159.37 155 16 ARG A 38 ? ? 58.03 156.74 156 16 LYS A 59 ? ? -40.34 -70.46 157 16 LYS A 76 ? ? -141.16 21.96 158 16 SER A 87 ? ? -174.90 133.47 159 16 SER A 88 ? ? 59.79 167.03 160 17 GLU A 21 ? ? -94.50 -71.73 161 17 LYS A 22 ? ? 165.24 137.71 162 17 GLU A 23 ? ? -39.27 159.35 163 17 SER A 30 ? ? -171.76 -177.91 164 17 MET A 34 ? ? -41.03 163.04 165 17 ARG A 38 ? ? 61.82 143.92 166 17 LYS A 76 ? ? -141.21 19.16 167 17 SER A 87 ? ? 51.54 79.48 168 18 GLU A 21 ? ? -96.21 -73.08 169 18 LYS A 22 ? ? 163.58 138.43 170 18 GLU A 23 ? ? -37.89 155.72 171 18 SER A 30 ? ? -170.41 -166.60 172 18 ARG A 38 ? ? -57.99 -179.56 173 18 LYS A 76 ? ? -149.64 44.82 174 18 SER A 88 ? ? 61.48 96.22 175 19 SER A 3 ? ? -178.26 147.16 176 19 SER A 5 ? ? -125.70 -53.79 177 19 GLU A 21 ? ? -100.27 -77.25 178 19 LYS A 22 ? ? 179.59 132.20 179 19 GLU A 23 ? ? -46.08 162.48 180 19 LYS A 59 ? ? -41.28 -76.12 181 19 LYS A 76 ? ? -147.24 29.11 182 19 SER A 87 ? ? 74.75 -59.81 183 19 SER A 88 ? ? 73.32 -62.91 184 20 ILE A 9 ? ? -62.41 -70.12 185 20 GLU A 21 ? ? -94.88 -75.58 186 20 LYS A 22 ? ? 170.14 133.77 187 20 GLU A 23 ? ? -39.22 158.83 188 20 SER A 30 ? ? -173.16 -169.92 189 20 ARG A 32 ? ? -170.84 145.06 190 20 MET A 34 ? ? 63.55 156.08 191 20 ARG A 37 ? ? -152.46 74.73 192 20 LYS A 59 ? ? -41.00 -76.34 193 20 LYS A 76 ? ? -145.12 26.09 194 20 SER A 87 ? ? -133.25 -57.72 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 1UHZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1UHZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.4mM dsrm U-15N, 13C; 20mM phosphate buffer NA(pH 6.0); 100mM NaCl; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1UHZ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.811 'data analysis' 'Kobayashi, N.' 4 CYANA 1.0.7 'structure solution' 'Guentert, P.' 5 CYANA 1.0.7 refinement 'Guentert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TYR N N N N 283 TYR CA C N S 284 TYR C C N N 285 TYR O O N N 286 TYR CB C N N 287 TYR CG C Y N 288 TYR CD1 C Y N 289 TYR CD2 C Y N 290 TYR CE1 C Y N 291 TYR CE2 C Y N 292 TYR CZ C Y N 293 TYR OH O N N 294 TYR OXT O N N 295 TYR H H N N 296 TYR H2 H N N 297 TYR HA H N N 298 TYR HB2 H N N 299 TYR HB3 H N N 300 TYR HD1 H N N 301 TYR HD2 H N N 302 TYR HE1 H N N 303 TYR HE2 H N N 304 TYR HH H N N 305 TYR HXT H N N 306 VAL N N N N 307 VAL CA C N S 308 VAL C C N N 309 VAL O O N N 310 VAL CB C N N 311 VAL CG1 C N N 312 VAL CG2 C N N 313 VAL OXT O N N 314 VAL H H N N 315 VAL H2 H N N 316 VAL HA H N N 317 VAL HB H N N 318 VAL HG11 H N N 319 VAL HG12 H N N 320 VAL HG13 H N N 321 VAL HG21 H N N 322 VAL HG22 H N N 323 VAL HG23 H N N 324 VAL HXT H N N 325 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TYR N CA sing N N 270 TYR N H sing N N 271 TYR N H2 sing N N 272 TYR CA C sing N N 273 TYR CA CB sing N N 274 TYR CA HA sing N N 275 TYR C O doub N N 276 TYR C OXT sing N N 277 TYR CB CG sing N N 278 TYR CB HB2 sing N N 279 TYR CB HB3 sing N N 280 TYR CG CD1 doub Y N 281 TYR CG CD2 sing Y N 282 TYR CD1 CE1 sing Y N 283 TYR CD1 HD1 sing N N 284 TYR CD2 CE2 doub Y N 285 TYR CD2 HD2 sing N N 286 TYR CE1 CZ doub Y N 287 TYR CE1 HE1 sing N N 288 TYR CE2 CZ sing Y N 289 TYR CE2 HE2 sing N N 290 TYR CZ OH sing N N 291 TYR OH HH sing N N 292 TYR OXT HXT sing N N 293 VAL N CA sing N N 294 VAL N H sing N N 295 VAL N H2 sing N N 296 VAL CA C sing N N 297 VAL CA CB sing N N 298 VAL CA HA sing N N 299 VAL C O doub N N 300 VAL C OXT sing N N 301 VAL CB CG1 sing N N 302 VAL CB CG2 sing N N 303 VAL CB HB sing N N 304 VAL CG1 HG11 sing N N 305 VAL CG1 HG12 sing N N 306 VAL CG1 HG13 sing N N 307 VAL CG2 HG21 sing N N 308 VAL CG2 HG22 sing N N 309 VAL CG2 HG23 sing N N 310 VAL OXT HXT sing N N 311 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1UHZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_