data_1UIY # _entry.id 1UIY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.342 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UIY RCSB RCSB005874 WWPDB D_1000005874 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003000159.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UIY _pdbx_database_status.recvd_initial_deposition_date 2003-07-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bagautdinov, B.' 1 'Kuramitsu, S.' 2 'Yokoyama, S.' 3 'Miyano, M.' 4 'Tahirov, T.H.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Crystal structure of enoyl-CoA hydratase from Thermus thermophilus HB8.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_volume 77 _citation.page_first 148 _citation.page_last 155 _citation.year 2021 _citation.journal_id_ASTM ACSFEN _citation.country US _citation.journal_id_ISSN 2053-230X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 33949975 _citation.pdbx_database_id_DOI 10.1107/S2053230X21004593 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Padavattan, S.' 1 ? primary 'Jos, S.' 2 0000-0002-7267-0826 primary 'Gogoi, H.' 3 0000-0003-3079-1627 primary 'Bagautdinov, B.' 4 0000-0002-0310-1769 # _cell.entry_id 1UIY _cell.length_a 131.233 _cell.length_b 131.233 _cell.length_c 110.608 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UIY _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Enoyl-CoA Hydratase' 27355.947 1 4.2.1.17 ? ? ? 2 non-polymer syn '1,4-DIETHYLENE DIOXIDE' 88.105 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 water nat water 18.015 72 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VQVEKGHVAVVFLNDPERRNPLSPE(MSE)ALSLLQALDDLEADPGVRAVVLTGRGKAFSAGADLAFLERVTELG AEENYRHSLSL(MSE)RLFHRVYTYPKPTVAAVNGPAVAGGAGLALACDLVV(MSE)DEEARLGYTEVKIGFVAALVSVI LVRAVGEKAAKDLLLTGRLVEAREAKALGLVNRIAPPGKALEEAKALAEEVAKNAPTSLRLTKELLLALPG(MSE)GLED GFRLAALANAWVRETGDLAEGIRAFFEKRPPRF ; _entity_poly.pdbx_seq_one_letter_code_can ;MVQVEKGHVAVVFLNDPERRNPLSPEMALSLLQALDDLEADPGVRAVVLTGRGKAFSAGADLAFLERVTELGAEENYRHS LSLMRLFHRVYTYPKPTVAAVNGPAVAGGAGLALACDLVVMDEEARLGYTEVKIGFVAALVSVILVRAVGEKAAKDLLLT GRLVEAREAKALGLVNRIAPPGKALEEAKALAEEVAKNAPTSLRLTKELLLALPGMGLEDGFRLAALANAWVRETGDLAE GIRAFFEKRPPRF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003000159.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 GLN n 1 4 VAL n 1 5 GLU n 1 6 LYS n 1 7 GLY n 1 8 HIS n 1 9 VAL n 1 10 ALA n 1 11 VAL n 1 12 VAL n 1 13 PHE n 1 14 LEU n 1 15 ASN n 1 16 ASP n 1 17 PRO n 1 18 GLU n 1 19 ARG n 1 20 ARG n 1 21 ASN n 1 22 PRO n 1 23 LEU n 1 24 SER n 1 25 PRO n 1 26 GLU n 1 27 MSE n 1 28 ALA n 1 29 LEU n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 GLN n 1 34 ALA n 1 35 LEU n 1 36 ASP n 1 37 ASP n 1 38 LEU n 1 39 GLU n 1 40 ALA n 1 41 ASP n 1 42 PRO n 1 43 GLY n 1 44 VAL n 1 45 ARG n 1 46 ALA n 1 47 VAL n 1 48 VAL n 1 49 LEU n 1 50 THR n 1 51 GLY n 1 52 ARG n 1 53 GLY n 1 54 LYS n 1 55 ALA n 1 56 PHE n 1 57 SER n 1 58 ALA n 1 59 GLY n 1 60 ALA n 1 61 ASP n 1 62 LEU n 1 63 ALA n 1 64 PHE n 1 65 LEU n 1 66 GLU n 1 67 ARG n 1 68 VAL n 1 69 THR n 1 70 GLU n 1 71 LEU n 1 72 GLY n 1 73 ALA n 1 74 GLU n 1 75 GLU n 1 76 ASN n 1 77 TYR n 1 78 ARG n 1 79 HIS n 1 80 SER n 1 81 LEU n 1 82 SER n 1 83 LEU n 1 84 MSE n 1 85 ARG n 1 86 LEU n 1 87 PHE n 1 88 HIS n 1 89 ARG n 1 90 VAL n 1 91 TYR n 1 92 THR n 1 93 TYR n 1 94 PRO n 1 95 LYS n 1 96 PRO n 1 97 THR n 1 98 VAL n 1 99 ALA n 1 100 ALA n 1 101 VAL n 1 102 ASN n 1 103 GLY n 1 104 PRO n 1 105 ALA n 1 106 VAL n 1 107 ALA n 1 108 GLY n 1 109 GLY n 1 110 ALA n 1 111 GLY n 1 112 LEU n 1 113 ALA n 1 114 LEU n 1 115 ALA n 1 116 CYS n 1 117 ASP n 1 118 LEU n 1 119 VAL n 1 120 VAL n 1 121 MSE n 1 122 ASP n 1 123 GLU n 1 124 GLU n 1 125 ALA n 1 126 ARG n 1 127 LEU n 1 128 GLY n 1 129 TYR n 1 130 THR n 1 131 GLU n 1 132 VAL n 1 133 LYS n 1 134 ILE n 1 135 GLY n 1 136 PHE n 1 137 VAL n 1 138 ALA n 1 139 ALA n 1 140 LEU n 1 141 VAL n 1 142 SER n 1 143 VAL n 1 144 ILE n 1 145 LEU n 1 146 VAL n 1 147 ARG n 1 148 ALA n 1 149 VAL n 1 150 GLY n 1 151 GLU n 1 152 LYS n 1 153 ALA n 1 154 ALA n 1 155 LYS n 1 156 ASP n 1 157 LEU n 1 158 LEU n 1 159 LEU n 1 160 THR n 1 161 GLY n 1 162 ARG n 1 163 LEU n 1 164 VAL n 1 165 GLU n 1 166 ALA n 1 167 ARG n 1 168 GLU n 1 169 ALA n 1 170 LYS n 1 171 ALA n 1 172 LEU n 1 173 GLY n 1 174 LEU n 1 175 VAL n 1 176 ASN n 1 177 ARG n 1 178 ILE n 1 179 ALA n 1 180 PRO n 1 181 PRO n 1 182 GLY n 1 183 LYS n 1 184 ALA n 1 185 LEU n 1 186 GLU n 1 187 GLU n 1 188 ALA n 1 189 LYS n 1 190 ALA n 1 191 LEU n 1 192 ALA n 1 193 GLU n 1 194 GLU n 1 195 VAL n 1 196 ALA n 1 197 LYS n 1 198 ASN n 1 199 ALA n 1 200 PRO n 1 201 THR n 1 202 SER n 1 203 LEU n 1 204 ARG n 1 205 LEU n 1 206 THR n 1 207 LYS n 1 208 GLU n 1 209 LEU n 1 210 LEU n 1 211 LEU n 1 212 ALA n 1 213 LEU n 1 214 PRO n 1 215 GLY n 1 216 MSE n 1 217 GLY n 1 218 LEU n 1 219 GLU n 1 220 ASP n 1 221 GLY n 1 222 PHE n 1 223 ARG n 1 224 LEU n 1 225 ALA n 1 226 ALA n 1 227 LEU n 1 228 ALA n 1 229 ASN n 1 230 ALA n 1 231 TRP n 1 232 VAL n 1 233 ARG n 1 234 GLU n 1 235 THR n 1 236 GLY n 1 237 ASP n 1 238 LEU n 1 239 ALA n 1 240 GLU n 1 241 GLY n 1 242 ILE n 1 243 ARG n 1 244 ALA n 1 245 PHE n 1 246 PHE n 1 247 GLU n 1 248 LYS n 1 249 ARG n 1 250 PRO n 1 251 PRO n 1 252 ARG n 1 253 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P83702_THETH _struct_ref.pdbx_db_accession P83702 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UIY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 253 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P83702 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 253 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 253 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DIO non-polymer . '1,4-DIETHYLENE DIOXIDE' ? 'C4 H8 O2' 88.105 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1UIY _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.28 _exptl_crystal.density_percent_sol 62.18 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.9 _exptl_crystal_grow.pdbx_details 'Na Citrate 0.72M, Acetate 0.1M, pH 5.9, microbatch, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-12-10 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.980 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL44B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL44B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.980 # _reflns.entry_id 1UIY _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 40.0 _reflns.number_all 66615 _reflns.number_obs 15761 _reflns.percent_possible_obs 99.95 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.2 _reflns.B_iso_Wilson_estimate 70.8 _reflns.pdbx_redundancy 7.69 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 2.98 _reflns_shell.percent_possible_all 86.2 _reflns_shell.Rmerge_I_obs 0.451 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.7 _reflns_shell.pdbx_redundancy 5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1684 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1UIY _refine.ls_d_res_high 2.85 _refine.ls_d_res_low 40.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I 0.0 _refine.ls_number_reflns_all 16595 _refine.ls_number_reflns_obs 14983 _refine.ls_number_reflns_R_free 778 _refine.ls_percent_reflns_obs 95.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.2035 _refine.ls_R_factor_R_free 0.267 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2DUB _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean 52.89 _refine.aniso_B[1][1] -7.06 _refine.aniso_B[1][2] 0.75 _refine.aniso_B[1][3] 0.0 _refine.aniso_B[2][2] -7.06 _refine.aniso_B[2][3] 0.0 _refine.aniso_B[3][3] 14.13 _refine.details ;Refinement performed using anomalous f', f'' library file for Se at 0.98 Angstrom ; _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1UIY _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_sigma_a_obs 0.40 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.33 _refine_analyze.Luzzati_sigma_a_free 0.41 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1907 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 72 _refine_hist.number_atoms_total 1997 _refine_hist.d_res_high 2.85 _refine_hist.d_res_low 40.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 21.1 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.96 ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_all _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_all 6 2.85 2.98 . 0.308 86.2 0.309 0.031 . 97 1781 . . 'X-RAY DIFFRACTION' . 6 2.98 3.14 . 0.27 94.1 0.298 0.030 . 98 1976 . . 'X-RAY DIFFRACTION' . 6 3.14 3.34 . 0.275 89.9 0.4 0.042 . 91 1841 . . 'X-RAY DIFFRACTION' . 6 3.34 3.59 . 0.232 96.4 0.321 0.034 . 91 1978 . . 'X-RAY DIFFRACTION' . 6 3.59 4.53 . 0.181 98.1 0.215 0.022 . 95 2067 . . 'X-RAY DIFFRACTION' . 6 4.53 5.70 . 0.154 98.5 0.226 0.023 . 97 2031 . . 'X-RAY DIFFRACTION' . # _struct.entry_id 1UIY _struct.title 'Crystal Structure of Enoyl-CoA Hydratase from Thermus Thermophilus HB8' _struct.pdbx_descriptor 'Enoyl-CoA Hydratase(E.C.4.2.1.17)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UIY _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'Lyase, beta-oxidation, crotonase, CoA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 24 ? ASP A 41 ? SER A 24 ASP A 41 1 ? 18 HELX_P HELX_P2 2 ASP A 61 ? THR A 69 ? ASP A 61 THR A 69 1 ? 9 HELX_P HELX_P3 3 GLY A 72 ? TYR A 93 ? GLY A 72 TYR A 93 1 ? 22 HELX_P HELX_P4 4 ALA A 107 ? ALA A 115 ? ALA A 107 ALA A 115 1 ? 9 HELX_P HELX_P5 5 THR A 130 ? ILE A 134 ? THR A 130 ILE A 134 5 ? 5 HELX_P HELX_P6 6 ALA A 138 ? VAL A 149 ? ALA A 138 VAL A 149 1 ? 12 HELX_P HELX_P7 7 GLY A 150 ? GLY A 161 ? GLY A 150 GLY A 161 1 ? 12 HELX_P HELX_P8 8 ALA A 166 ? LEU A 172 ? ALA A 166 LEU A 172 1 ? 7 HELX_P HELX_P9 9 LYS A 183 ? ASN A 198 ? LYS A 183 ASN A 198 1 ? 16 HELX_P HELX_P10 10 ALA A 199 ? LEU A 213 ? ALA A 199 LEU A 213 1 ? 15 HELX_P HELX_P11 11 PRO A 214 ? MSE A 216 ? PRO A 214 MSE A 216 5 ? 3 HELX_P HELX_P12 12 GLY A 217 ? VAL A 232 ? GLY A 217 VAL A 232 1 ? 16 HELX_P HELX_P13 13 THR A 235 ? GLU A 247 ? THR A 235 GLU A 247 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A VAL 2 N ? ? A MSE 1 A VAL 2 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A GLU 26 C ? ? ? 1_555 A MSE 27 N ? ? A GLU 26 A MSE 27 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A MSE 27 C ? ? ? 1_555 A ALA 28 N ? ? A MSE 27 A ALA 28 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A LEU 83 C ? ? ? 1_555 A MSE 84 N ? ? A LEU 83 A MSE 84 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? A MSE 84 C ? ? ? 1_555 A ARG 85 N ? ? A MSE 84 A ARG 85 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale6 covale both ? A VAL 120 C ? ? ? 1_555 A MSE 121 N ? ? A VAL 120 A MSE 121 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale7 covale both ? A MSE 121 C ? ? ? 1_555 A ASP 122 N ? ? A MSE 121 A ASP 122 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale8 covale both ? A GLY 215 C ? ? ? 1_555 A MSE 216 N ? ? A GLY 215 A MSE 216 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale9 covale both ? A MSE 216 C ? ? ? 1_555 A GLY 217 N ? ? A MSE 216 A GLY 217 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel B 1 2 ? parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 2 ? GLU A 5 ? VAL A 2 GLU A 5 A 2 VAL A 9 ? LEU A 14 ? VAL A 9 LEU A 14 A 3 ALA A 46 ? GLY A 51 ? ALA A 46 GLY A 51 A 4 THR A 97 ? VAL A 101 ? THR A 97 VAL A 101 A 5 LEU A 118 ? ASP A 122 ? LEU A 118 ASP A 122 A 6 ARG A 177 ? ALA A 179 ? ARG A 177 ALA A 179 B 1 ALA A 105 ? VAL A 106 ? ALA A 105 VAL A 106 B 2 ARG A 126 ? GLY A 128 ? ARG A 126 GLY A 128 B 3 LEU A 163 ? GLU A 165 ? LEU A 163 GLU A 165 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 3 ? N GLN A 3 O PHE A 13 ? O PHE A 13 A 2 3 N ALA A 10 ? N ALA A 10 O VAL A 48 ? O VAL A 48 A 3 4 N LEU A 49 ? N LEU A 49 O ALA A 100 ? O ALA A 100 A 4 5 N VAL A 101 ? N VAL A 101 O ASP A 122 ? O ASP A 122 A 5 6 N MSE A 121 ? N MSE A 121 O ARG A 177 ? O ARG A 177 B 1 2 N ALA A 105 ? N ALA A 105 O ARG A 126 ? O ARG A 126 B 2 3 N LEU A 127 ? N LEU A 127 O VAL A 164 ? O VAL A 164 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A DIO 500 ? 2 'BINDING SITE FOR RESIDUE DIO A 500' AC2 Software A GOL 300 ? 3 'BINDING SITE FOR RESIDUE GOL A 300' AC3 Software A GOL 400 ? 3 'BINDING SITE FOR RESIDUE GOL A 400' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ARG A 52 ? ARG A 52 . ? 1_555 ? 2 AC1 2 GLY A 53 ? GLY A 53 . ? 1_555 ? 3 AC2 3 ARG A 20 ? ARG A 20 . ? 1_555 ? 4 AC2 3 LYS A 54 ? LYS A 54 . ? 1_555 ? 5 AC2 3 PRO A 104 ? PRO A 104 . ? 1_555 ? 6 AC3 3 GLU A 131 ? GLU A 131 . ? 1_555 ? 7 AC3 3 ASN A 229 ? ASN A 229 . ? 3_665 ? 8 AC3 3 ARG A 233 ? ARG A 233 . ? 3_665 ? # _database_PDB_matrix.entry_id 1UIY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UIY _atom_sites.fract_transf_matrix[1][1] 0.00762 _atom_sites.fract_transf_matrix[1][2] 0.00440 _atom_sites.fract_transf_matrix[1][3] 0.00000 _atom_sites.fract_transf_matrix[2][1] 0.00000 _atom_sites.fract_transf_matrix[2][2] 0.00880 _atom_sites.fract_transf_matrix[2][3] 0.00000 _atom_sites.fract_transf_matrix[3][1] 0.00000 _atom_sites.fract_transf_matrix[3][2] 0.00000 _atom_sites.fract_transf_matrix[3][3] 0.00904 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 MSE 27 27 27 MSE MSE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 MSE 84 84 84 MSE MSE A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 MSE 121 121 121 MSE MSE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 MSE 216 216 216 MSE MSE A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ASN 229 229 229 ASN ASN A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 TRP 231 231 231 TRP TRP A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 ILE 242 242 242 ILE ILE A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 PRO 251 251 251 PRO PRO A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 PHE 253 253 253 PHE PHE A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DIO 1 500 500 DIO DOX A . C 3 GOL 1 300 300 GOL GOL A . D 3 GOL 1 400 400 GOL GOL A . E 4 HOH 1 501 1 HOH HOH A . E 4 HOH 2 502 2 HOH HOH A . E 4 HOH 3 503 3 HOH HOH A . E 4 HOH 4 504 4 HOH HOH A . E 4 HOH 5 505 6 HOH HOH A . E 4 HOH 6 506 7 HOH HOH A . E 4 HOH 7 507 8 HOH HOH A . E 4 HOH 8 508 9 HOH HOH A . E 4 HOH 9 509 10 HOH HOH A . E 4 HOH 10 510 11 HOH HOH A . E 4 HOH 11 511 12 HOH HOH A . E 4 HOH 12 512 13 HOH HOH A . E 4 HOH 13 513 14 HOH HOH A . E 4 HOH 14 514 15 HOH HOH A . E 4 HOH 15 515 16 HOH HOH A . E 4 HOH 16 516 17 HOH HOH A . E 4 HOH 17 517 18 HOH HOH A . E 4 HOH 18 518 19 HOH HOH A . E 4 HOH 19 519 20 HOH HOH A . E 4 HOH 20 520 21 HOH HOH A . E 4 HOH 21 521 22 HOH HOH A . E 4 HOH 22 522 23 HOH HOH A . E 4 HOH 23 523 24 HOH HOH A . E 4 HOH 24 524 25 HOH HOH A . E 4 HOH 25 525 26 HOH HOH A . E 4 HOH 26 526 27 HOH HOH A . E 4 HOH 27 527 28 HOH HOH A . E 4 HOH 28 528 29 HOH HOH A . E 4 HOH 29 529 30 HOH HOH A . E 4 HOH 30 530 31 HOH HOH A . E 4 HOH 31 531 32 HOH HOH A . E 4 HOH 32 532 33 HOH HOH A . E 4 HOH 33 533 34 HOH HOH A . E 4 HOH 34 534 35 HOH HOH A . E 4 HOH 35 535 36 HOH HOH A . E 4 HOH 36 536 37 HOH HOH A . E 4 HOH 37 537 38 HOH HOH A . E 4 HOH 38 538 39 HOH HOH A . E 4 HOH 39 539 40 HOH HOH A . E 4 HOH 40 540 41 HOH HOH A . E 4 HOH 41 541 42 HOH HOH A . E 4 HOH 42 542 43 HOH HOH A . E 4 HOH 43 543 44 HOH HOH A . E 4 HOH 44 544 45 HOH HOH A . E 4 HOH 45 545 46 HOH HOH A . E 4 HOH 46 546 47 HOH HOH A . E 4 HOH 47 547 48 HOH HOH A . E 4 HOH 48 548 49 HOH HOH A . E 4 HOH 49 549 50 HOH HOH A . E 4 HOH 50 550 51 HOH HOH A . E 4 HOH 51 551 52 HOH HOH A . E 4 HOH 52 552 53 HOH HOH A . E 4 HOH 53 553 54 HOH HOH A . E 4 HOH 54 554 55 HOH HOH A . E 4 HOH 55 555 56 HOH HOH A . E 4 HOH 56 556 57 HOH HOH A . E 4 HOH 57 557 58 HOH HOH A . E 4 HOH 58 558 59 HOH HOH A . E 4 HOH 59 559 60 HOH HOH A . E 4 HOH 60 560 61 HOH HOH A . E 4 HOH 61 561 62 HOH HOH A . E 4 HOH 62 562 63 HOH HOH A . E 4 HOH 63 563 64 HOH HOH A . E 4 HOH 64 564 65 HOH HOH A . E 4 HOH 65 565 66 HOH HOH A . E 4 HOH 66 566 67 HOH HOH A . E 4 HOH 67 567 68 HOH HOH A . E 4 HOH 68 568 69 HOH HOH A . E 4 HOH 69 569 70 HOH HOH A . E 4 HOH 70 570 71 HOH HOH A . E 4 HOH 71 571 72 HOH HOH A . E 4 HOH 72 572 73 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 27 A MSE 27 ? MET SELENOMETHIONINE 3 A MSE 84 A MSE 84 ? MET SELENOMETHIONINE 4 A MSE 121 A MSE 121 ? MET SELENOMETHIONINE 5 A MSE 216 A MSE 216 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 36390 ? 1 MORE -222 ? 1 'SSA (A^2)' 50940 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 131.2330000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 65.6165000000 -0.8660254038 -0.5000000000 0.0000000000 113.6511118148 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 16_545 y+1/3,x-1/3,-z+2/3 -0.5000000000 0.8660254038 0.0000000000 65.6165000000 0.8660254038 0.5000000000 0.0000000000 -37.8837039383 0.0000000000 0.0000000000 -1.0000000000 73.7386666667 5 'crystal symmetry operation' 17_555 x-y+1/3,-y+2/3,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 75.7674078766 0.0000000000 0.0000000000 -1.0000000000 73.7386666667 6 'crystal symmetry operation' 18_655 -x+4/3,-x+y+2/3,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 131.2330000000 -0.8660254038 0.5000000000 0.0000000000 75.7674078766 0.0000000000 0.0000000000 -1.0000000000 73.7386666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-05 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-05-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.country' 2 4 'Structure model' '_citation.journal_abbrev' 3 4 'Structure model' '_citation.journal_id_ASTM' 4 4 'Structure model' '_citation.journal_id_CSD' 5 4 'Structure model' '_citation.journal_id_ISSN' 6 4 'Structure model' '_citation.journal_volume' 7 4 'Structure model' '_citation.page_first' 8 4 'Structure model' '_citation.page_last' 9 4 'Structure model' '_citation.pdbx_database_id_DOI' 10 4 'Structure model' '_citation.pdbx_database_id_PubMed' 11 4 'Structure model' '_citation.title' 12 4 'Structure model' '_citation.year' 13 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 14 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 15 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 16 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SCALEPACK 'data scaling' . ? 2 CNS refinement 1.1 ? 3 HKL-2000 'data reduction' . ? 4 CNS phasing 1.1 ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 234 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 234 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 18_655 _pdbx_validate_symm_contact.dist 1.90 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 16 ? ? -167.73 39.99 2 1 PRO A 17 ? ? -28.61 -69.05 3 1 ARG A 20 ? ? 83.73 28.60 4 1 LEU A 23 ? ? -79.95 49.80 5 1 PRO A 42 ? ? -57.22 -9.35 6 1 SER A 57 ? ? -174.05 106.05 7 1 ALA A 58 ? ? -172.18 89.36 8 1 VAL A 68 ? ? -14.58 -60.91 9 1 THR A 69 ? ? -59.96 -2.25 10 1 TYR A 93 ? ? -37.78 130.68 11 1 ALA A 107 ? ? 58.42 -131.74 12 1 ALA A 138 ? ? -77.60 44.33 13 1 LYS A 248 ? ? 33.75 48.55 14 1 ARG A 252 ? ? -116.26 70.68 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1,4-DIETHYLENE DIOXIDE' DIO 3 GLYCEROL GOL 4 water HOH #