data_1UJB # _entry.id 1UJB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UJB RCSB RCSB005887 WWPDB D_1000005887 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1UJC _pdbx_database_related.details '1UJC contains the same protein complexed with tungstate.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UJB _pdbx_database_status.recvd_initial_deposition_date 2003-07-31 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hamada, K.' 1 'Kato, M.' 2 'Shimizu, T.' 3 'Ihara, K.' 4 'Mizuno, T.' 5 'Hakoshima, T.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.' 'Genes Cells' 10 1 11 2005 ? UK 1356-9597 ? ? 15670209 10.1111/j.1365-2443.2005.00817.x 1 ;Crystallographic characterization of a novel protein SixA which exhibits phospho-histidine phosphatase activity in the multistep His-Asp phosphorelay ; 'Acta Crystallogr.,Sect.D' 55 269 271 1999 ABCRE6 DK 0907-4449 0766 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hamada, K.' 1 primary 'Kato, M.' 2 primary 'Shimizu, T.' 3 primary 'Ihara, K.' 4 primary 'Mizuno, T.' 5 primary 'Hakoshima, T.' 6 1 'Hamada, K.' 7 1 'Kato, M.' 8 1 'Mizuno, T.' 9 1 'Hakoshima, T.' 10 # _cell.entry_id 1UJB _cell.length_a 39.260 _cell.length_b 48.620 _cell.length_c 83.180 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UJB _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphohistidine phosphatase sixA' 17218.699 1 3.1.3.- ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 113 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'protein histidine phosphatase SixA, RX6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELT PCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLKMAKA I ; _entity_poly.pdbx_seq_one_letter_code_can ;MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELT PCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLKMAKA I ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 VAL n 1 4 PHE n 1 5 ILE n 1 6 MET n 1 7 ARG n 1 8 HIS n 1 9 GLY n 1 10 ASP n 1 11 ALA n 1 12 ALA n 1 13 LEU n 1 14 ASP n 1 15 ALA n 1 16 ALA n 1 17 SER n 1 18 ASP n 1 19 SER n 1 20 VAL n 1 21 ARG n 1 22 PRO n 1 23 LEU n 1 24 THR n 1 25 THR n 1 26 ASN n 1 27 GLY n 1 28 CYS n 1 29 ASP n 1 30 GLU n 1 31 SER n 1 32 ARG n 1 33 LEU n 1 34 MET n 1 35 ALA n 1 36 ASN n 1 37 TRP n 1 38 LEU n 1 39 LYS n 1 40 GLY n 1 41 GLN n 1 42 LYS n 1 43 VAL n 1 44 GLU n 1 45 ILE n 1 46 GLU n 1 47 ARG n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 SER n 1 52 PRO n 1 53 PHE n 1 54 LEU n 1 55 ARG n 1 56 ALA n 1 57 GLU n 1 58 GLN n 1 59 THR n 1 60 LEU n 1 61 GLU n 1 62 GLU n 1 63 VAL n 1 64 GLY n 1 65 ASP n 1 66 CYS n 1 67 LEU n 1 68 ASN n 1 69 LEU n 1 70 PRO n 1 71 SER n 1 72 SER n 1 73 ALA n 1 74 GLU n 1 75 VAL n 1 76 LEU n 1 77 PRO n 1 78 GLU n 1 79 LEU n 1 80 THR n 1 81 PRO n 1 82 CYS n 1 83 GLY n 1 84 ASP n 1 85 VAL n 1 86 GLY n 1 87 LEU n 1 88 VAL n 1 89 SER n 1 90 ALA n 1 91 TYR n 1 92 LEU n 1 93 GLN n 1 94 ALA n 1 95 LEU n 1 96 THR n 1 97 ASN n 1 98 GLU n 1 99 GLY n 1 100 VAL n 1 101 ALA n 1 102 SER n 1 103 VAL n 1 104 LEU n 1 105 VAL n 1 106 ILE n 1 107 SER n 1 108 HIS n 1 109 LEU n 1 110 PRO n 1 111 LEU n 1 112 VAL n 1 113 GLY n 1 114 TYR n 1 115 LEU n 1 116 VAL n 1 117 ALA n 1 118 GLU n 1 119 LEU n 1 120 CYS n 1 121 PRO n 1 122 GLY n 1 123 GLU n 1 124 THR n 1 125 PRO n 1 126 PRO n 1 127 MET n 1 128 PHE n 1 129 THR n 1 130 THR n 1 131 SER n 1 132 ALA n 1 133 ILE n 1 134 ALA n 1 135 SER n 1 136 VAL n 1 137 THR n 1 138 LEU n 1 139 ASP n 1 140 GLU n 1 141 SER n 1 142 GLY n 1 143 ASN n 1 144 GLY n 1 145 THR n 1 146 PHE n 1 147 ASN n 1 148 TRP n 1 149 GLN n 1 150 MET n 1 151 SER n 1 152 PRO n 1 153 CYS n 1 154 ASN n 1 155 LEU n 1 156 LYS n 1 157 MET n 1 158 ALA n 1 159 LYS n 1 160 ALA n 1 161 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIXA_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELT PCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLKMAKA I ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P76502 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UJB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P76502 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1UJB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 44.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 283 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.6 _exptl_crystal_grow.pdbx_details 'PEG6000, CaCl2, MES, pH 6.6, VAPOR DIFFUSION, HANGING DROP, temperature 283K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 288 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU300' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1UJB _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.06 _reflns.number_obs 9936 _reflns.number_all ? _reflns.percent_possible_obs 95.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 13.8 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.15 _reflns_shell.percent_possible_all 91.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1UJB _refine.ls_number_reflns_obs 9928 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 6161139.20 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 41.98 _refine.ls_d_res_high 2.06 _refine.ls_percent_reflns_obs 95.8 _refine.ls_R_factor_obs 0.173 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.173 _refine.ls_R_factor_R_free 0.229 _refine.ls_R_factor_R_free_error 0.007 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.4 _refine.ls_number_reflns_R_free 1030 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 22.0 _refine.aniso_B[1][1] -0.15 _refine.aniso_B[2][2] -0.89 _refine.aniso_B[3][3] 1.03 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.388391 _refine.solvent_model_param_bsol 61.6806 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1UJB _refine_analyze.Luzzati_coordinate_error_obs 0.20 _refine_analyze.Luzzati_sigma_a_obs 0.17 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.25 _refine_analyze.Luzzati_sigma_a_free 0.13 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1165 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1279 _refine_hist.d_res_high 2.06 _refine_hist.d_res_low 41.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.5 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.18 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.50 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.35 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 10.78 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 7.43 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.13 _refine_ls_shell.number_reflns_R_work 748 _refine_ls_shell.R_factor_R_work 0.207 _refine_ls_shell.percent_reflns_obs 45.3 _refine_ls_shell.R_factor_R_free 0.208 _refine_ls_shell.R_factor_R_free_error 0.023 _refine_ls_shell.percent_reflns_R_free 9.7 _refine_ls_shell.number_reflns_R_free 80 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1UJB _struct.title 'Structure of the protein histidine phosphatase SixA' _struct.pdbx_descriptor 'Phosphohistidine phosphatase sixA(E.C.3.1.3.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UJB _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'alpha-beta fold, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 17 ? ARG A 21 ? SER A 17 ARG A 21 5 ? 5 HELX_P HELX_P2 2 THR A 24 ? GLN A 41 ? THR A 24 GLN A 41 1 ? 18 HELX_P HELX_P3 3 PHE A 53 ? ASP A 65 ? PHE A 53 ASP A 65 1 ? 13 HELX_P HELX_P4 4 PRO A 77 ? THR A 80 ? PRO A 77 THR A 80 5 ? 4 HELX_P HELX_P5 5 ASP A 84 ? GLY A 99 ? ASP A 84 GLY A 99 1 ? 16 HELX_P HELX_P6 6 PRO A 110 ? CYS A 120 ? PRO A 110 CYS A 120 1 ? 11 HELX_P HELX_P7 7 SER A 151 ? LYS A 156 ? SER A 151 LYS A 156 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 162 A HOH 218 1_555 ? ? ? ? ? ? ? 2.499 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 65 O ? ? A CA 162 A ASP 65 1_555 ? ? ? ? ? ? ? 2.428 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 162 A HOH 219 1_555 ? ? ? ? ? ? ? 2.573 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 A GLY 99 O ? ? A CA 162 A GLY 99 3_545 ? ? ? ? ? ? ? 2.511 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 162 A HOH 187 3_545 ? ? ? ? ? ? ? 2.865 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 109 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 109 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 110 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 110 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.18 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 74 ? VAL A 75 ? GLU A 74 VAL A 75 A 2 ARG A 47 ? VAL A 50 ? ARG A 47 VAL A 50 A 3 SER A 102 ? SER A 107 ? SER A 102 SER A 107 A 4 GLN A 2 ? ARG A 7 ? GLN A 2 ARG A 7 A 5 ILE A 133 ? LEU A 138 ? ILE A 133 LEU A 138 A 6 GLY A 144 ? MET A 150 ? GLY A 144 MET A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 74 ? O GLU A 74 N VAL A 50 ? N VAL A 50 A 2 3 N LEU A 49 ? N LEU A 49 O LEU A 104 ? O LEU A 104 A 3 4 O VAL A 105 ? O VAL A 105 N MET A 6 ? N MET A 6 A 4 5 N VAL A 3 ? N VAL A 3 O VAL A 136 ? O VAL A 136 A 5 6 N SER A 135 ? N SER A 135 O TRP A 148 ? O TRP A 148 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 162' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 65 ? ASP A 65 . ? 1_555 ? 2 AC1 5 GLY A 99 ? GLY A 99 . ? 3_545 ? 3 AC1 5 HOH C . ? HOH A 187 . ? 3_545 ? 4 AC1 5 HOH C . ? HOH A 218 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH A 219 . ? 1_555 ? # _database_PDB_matrix.entry_id 1UJB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UJB _atom_sites.fract_transf_matrix[1][1] 0.025471 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020568 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012022 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 MET 127 127 127 MET MET A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 TRP 148 148 148 TRP TRP A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 MET 150 150 150 MET MET A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 MET 157 157 ? ? ? A . n A 1 158 ALA 158 158 ? ? ? A . n A 1 159 LYS 159 159 ? ? ? A . n A 1 160 ALA 160 160 ? ? ? A . n A 1 161 ILE 161 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 162 157 CA CA A . C 3 HOH 1 163 158 HOH WAT A . C 3 HOH 2 164 159 HOH WAT A . C 3 HOH 3 165 160 HOH WAT A . C 3 HOH 4 166 161 HOH WAT A . C 3 HOH 5 167 162 HOH WAT A . C 3 HOH 6 168 163 HOH WAT A . C 3 HOH 7 169 164 HOH WAT A . C 3 HOH 8 170 165 HOH WAT A . C 3 HOH 9 171 166 HOH WAT A . C 3 HOH 10 172 167 HOH WAT A . C 3 HOH 11 173 168 HOH WAT A . C 3 HOH 12 174 169 HOH WAT A . C 3 HOH 13 175 170 HOH WAT A . C 3 HOH 14 176 171 HOH WAT A . C 3 HOH 15 177 172 HOH WAT A . C 3 HOH 16 178 173 HOH WAT A . C 3 HOH 17 179 174 HOH WAT A . C 3 HOH 18 180 175 HOH WAT A . C 3 HOH 19 181 176 HOH WAT A . C 3 HOH 20 182 177 HOH WAT A . C 3 HOH 21 183 178 HOH WAT A . C 3 HOH 22 184 179 HOH WAT A . C 3 HOH 23 185 180 HOH WAT A . C 3 HOH 24 186 181 HOH WAT A . C 3 HOH 25 187 182 HOH WAT A . C 3 HOH 26 188 183 HOH WAT A . C 3 HOH 27 189 184 HOH WAT A . C 3 HOH 28 190 185 HOH WAT A . C 3 HOH 29 191 186 HOH WAT A . C 3 HOH 30 192 187 HOH WAT A . C 3 HOH 31 193 188 HOH WAT A . C 3 HOH 32 194 189 HOH WAT A . C 3 HOH 33 195 190 HOH WAT A . C 3 HOH 34 196 191 HOH WAT A . C 3 HOH 35 197 192 HOH WAT A . C 3 HOH 36 198 193 HOH WAT A . C 3 HOH 37 199 194 HOH WAT A . C 3 HOH 38 200 195 HOH WAT A . C 3 HOH 39 201 196 HOH WAT A . C 3 HOH 40 202 197 HOH WAT A . C 3 HOH 41 203 198 HOH WAT A . C 3 HOH 42 204 199 HOH WAT A . C 3 HOH 43 205 200 HOH WAT A . C 3 HOH 44 206 201 HOH WAT A . C 3 HOH 45 207 202 HOH WAT A . C 3 HOH 46 208 203 HOH WAT A . C 3 HOH 47 209 204 HOH WAT A . C 3 HOH 48 210 205 HOH WAT A . C 3 HOH 49 211 206 HOH WAT A . C 3 HOH 50 212 207 HOH WAT A . C 3 HOH 51 213 208 HOH WAT A . C 3 HOH 52 214 209 HOH WAT A . C 3 HOH 53 215 210 HOH WAT A . C 3 HOH 54 216 211 HOH WAT A . C 3 HOH 55 217 212 HOH WAT A . C 3 HOH 56 218 213 HOH WAT A . C 3 HOH 57 219 214 HOH WAT A . C 3 HOH 58 220 215 HOH WAT A . C 3 HOH 59 221 216 HOH WAT A . C 3 HOH 60 222 217 HOH WAT A . C 3 HOH 61 223 218 HOH WAT A . C 3 HOH 62 224 219 HOH WAT A . C 3 HOH 63 225 220 HOH WAT A . C 3 HOH 64 226 221 HOH WAT A . C 3 HOH 65 227 222 HOH WAT A . C 3 HOH 66 228 223 HOH WAT A . C 3 HOH 67 229 224 HOH WAT A . C 3 HOH 68 230 225 HOH WAT A . C 3 HOH 69 231 226 HOH WAT A . C 3 HOH 70 232 227 HOH WAT A . C 3 HOH 71 233 228 HOH WAT A . C 3 HOH 72 234 229 HOH WAT A . C 3 HOH 73 235 230 HOH WAT A . C 3 HOH 74 236 231 HOH WAT A . C 3 HOH 75 237 232 HOH WAT A . C 3 HOH 76 238 233 HOH WAT A . C 3 HOH 77 239 234 HOH WAT A . C 3 HOH 78 240 235 HOH WAT A . C 3 HOH 79 241 236 HOH WAT A . C 3 HOH 80 242 237 HOH WAT A . C 3 HOH 81 243 238 HOH WAT A . C 3 HOH 82 244 239 HOH WAT A . C 3 HOH 83 245 240 HOH WAT A . C 3 HOH 84 246 241 HOH WAT A . C 3 HOH 85 247 242 HOH WAT A . C 3 HOH 86 248 243 HOH WAT A . C 3 HOH 87 249 244 HOH WAT A . C 3 HOH 88 250 245 HOH WAT A . C 3 HOH 89 251 246 HOH WAT A . C 3 HOH 90 252 247 HOH WAT A . C 3 HOH 91 253 248 HOH WAT A . C 3 HOH 92 254 249 HOH WAT A . C 3 HOH 93 255 250 HOH WAT A . C 3 HOH 94 256 251 HOH WAT A . C 3 HOH 95 257 252 HOH WAT A . C 3 HOH 96 258 253 HOH WAT A . C 3 HOH 97 259 254 HOH WAT A . C 3 HOH 98 260 255 HOH WAT A . C 3 HOH 99 261 256 HOH WAT A . C 3 HOH 100 262 257 HOH WAT A . C 3 HOH 101 263 258 HOH WAT A . C 3 HOH 102 264 259 HOH WAT A . C 3 HOH 103 265 260 HOH WAT A . C 3 HOH 104 266 261 HOH WAT A . C 3 HOH 105 267 262 HOH WAT A . C 3 HOH 106 268 263 HOH WAT A . C 3 HOH 107 269 264 HOH WAT A . C 3 HOH 108 270 265 HOH WAT A . C 3 HOH 109 271 266 HOH WAT A . C 3 HOH 110 272 267 HOH WAT A . C 3 HOH 111 273 268 HOH WAT A . C 3 HOH 112 274 269 HOH WAT A . C 3 HOH 113 275 270 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? C HOH . ? A HOH 218 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A ASP 65 ? A ASP 65 ? 1_555 84.8 ? 2 O ? C HOH . ? A HOH 218 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? C HOH . ? A HOH 219 ? 1_555 173.9 ? 3 O ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? C HOH . ? A HOH 219 ? 1_555 90.6 ? 4 O ? C HOH . ? A HOH 218 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A GLY 99 ? A GLY 99 ? 3_545 89.5 ? 5 O ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A GLY 99 ? A GLY 99 ? 3_545 146.8 ? 6 O ? C HOH . ? A HOH 219 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A GLY 99 ? A GLY 99 ? 3_545 92.1 ? 7 O ? C HOH . ? A HOH 218 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? C HOH . ? A HOH 187 ? 3_545 81.5 ? 8 O ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? C HOH . ? A HOH 187 ? 3_545 137.9 ? 9 O ? C HOH . ? A HOH 219 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? C HOH . ? A HOH 187 ? 3_545 104.6 ? 10 O ? A GLY 99 ? A GLY 99 ? 3_545 CA ? B CA . ? A CA 162 ? 1_555 O ? C HOH . ? A HOH 187 ? 3_545 72.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-25 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 PROCESS 'data reduction' . ? 2 CCP4 'data scaling' '(SCALA)' ? 3 MLPHARE phasing . ? 4 X-PLOR refinement 3.851 ? 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 107 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -140.37 _pdbx_validate_torsion.psi -156.73 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 157 ? A MET 157 2 1 Y 1 A ALA 158 ? A ALA 158 3 1 Y 1 A LYS 159 ? A LYS 159 4 1 Y 1 A ALA 160 ? A ALA 160 5 1 Y 1 A ILE 161 ? A ILE 161 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH #