data_1ULO # _entry.id 1ULO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ULO pdb_00001ulo 10.2210/pdb1ulo/pdb WWPDB D_1000176951 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ULP _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ULO _pdbx_database_status.recvd_initial_deposition_date 1996-07-27 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Johnson, P.E.' 1 'Mcintosh, L.P.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structure of the N-terminal cellulose-binding domain of Cellulomonas fimi CenC determined by nuclear magnetic resonance spectroscopy. ; Biochemistry 35 14381 14394 1996 BICHAW US 0006-2960 0033 ? 8916925 10.1021/bi961612s 1 ;Interaction of Soluble Cellooligosaccharides with the N-Terminal Cellulose-Binding Domain of Cellulomonas Fimi Cenc. 2. NMR and Ultraviolet Absorption Spectroscopy ; Biochemistry 35 13895 ? 1996 BICHAW US 0006-2960 0033 ? ? ? 2 'The Binding of Cellulomonas Fimi Endoglucanase C (Cenc) to Cellulose and Sephadex is Mediated by the N-Terminal Repeats' Mol.Microbiol. 6 1243 ? 1992 MOMIEE UK 0950-382X 2007 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Johnson, P.E.' 1 ? primary 'Joshi, M.D.' 2 ? primary 'Tomme, P.' 3 ? primary 'Kilburn, D.G.' 4 ? primary 'McIntosh, L.P.' 5 ? 1 'Johnson, P.E.' 6 ? 1 'Tomme, P.' 7 ? 1 'Joshi, M.D.' 8 ? 1 'Mcintosh, L.P.' 9 ? 2 'Coutinho, J.B.' 10 ? 2 'Gilkes, N.R.' 11 ? 2 'Warren, R.A.' 12 ? 2 'Kilburn, D.G.' 13 ? 2 'Miller Junior, R.C.' 14 ? # _cell.entry_id 1ULO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ULO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ENDOGLUCANASE C' _entity.formula_weight 15429.660 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.4 _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL CELLULOSE-BINDING DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CENC, ENDO-1,4-BETA-GLUCANASE C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ASPIGEGTFDDGPEGWVAYGTDGPLDTSTGALCVAVPAGSAQYGVGVVLNGVAIEEGTTYTLRYTATASTDVTVRALVGQ NGAPYGTVLDTSPALTSEPRQVTETFTASATYPATPAADDPEGQIAFQLGGFSADAWTLCLDDVALDSEVEL ; _entity_poly.pdbx_seq_one_letter_code_can ;ASPIGEGTFDDGPEGWVAYGTDGPLDTSTGALCVAVPAGSAQYGVGVVLNGVAIEEGTTYTLRYTATASTDVTVRALVGQ NGAPYGTVLDTSPALTSEPRQVTETFTASATYPATPAADDPEGQIAFQLGGFSADAWTLCLDDVALDSEVEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 PRO n 1 4 ILE n 1 5 GLY n 1 6 GLU n 1 7 GLY n 1 8 THR n 1 9 PHE n 1 10 ASP n 1 11 ASP n 1 12 GLY n 1 13 PRO n 1 14 GLU n 1 15 GLY n 1 16 TRP n 1 17 VAL n 1 18 ALA n 1 19 TYR n 1 20 GLY n 1 21 THR n 1 22 ASP n 1 23 GLY n 1 24 PRO n 1 25 LEU n 1 26 ASP n 1 27 THR n 1 28 SER n 1 29 THR n 1 30 GLY n 1 31 ALA n 1 32 LEU n 1 33 CYS n 1 34 VAL n 1 35 ALA n 1 36 VAL n 1 37 PRO n 1 38 ALA n 1 39 GLY n 1 40 SER n 1 41 ALA n 1 42 GLN n 1 43 TYR n 1 44 GLY n 1 45 VAL n 1 46 GLY n 1 47 VAL n 1 48 VAL n 1 49 LEU n 1 50 ASN n 1 51 GLY n 1 52 VAL n 1 53 ALA n 1 54 ILE n 1 55 GLU n 1 56 GLU n 1 57 GLY n 1 58 THR n 1 59 THR n 1 60 TYR n 1 61 THR n 1 62 LEU n 1 63 ARG n 1 64 TYR n 1 65 THR n 1 66 ALA n 1 67 THR n 1 68 ALA n 1 69 SER n 1 70 THR n 1 71 ASP n 1 72 VAL n 1 73 THR n 1 74 VAL n 1 75 ARG n 1 76 ALA n 1 77 LEU n 1 78 VAL n 1 79 GLY n 1 80 GLN n 1 81 ASN n 1 82 GLY n 1 83 ALA n 1 84 PRO n 1 85 TYR n 1 86 GLY n 1 87 THR n 1 88 VAL n 1 89 LEU n 1 90 ASP n 1 91 THR n 1 92 SER n 1 93 PRO n 1 94 ALA n 1 95 LEU n 1 96 THR n 1 97 SER n 1 98 GLU n 1 99 PRO n 1 100 ARG n 1 101 GLN n 1 102 VAL n 1 103 THR n 1 104 GLU n 1 105 THR n 1 106 PHE n 1 107 THR n 1 108 ALA n 1 109 SER n 1 110 ALA n 1 111 THR n 1 112 TYR n 1 113 PRO n 1 114 ALA n 1 115 THR n 1 116 PRO n 1 117 ALA n 1 118 ALA n 1 119 ASP n 1 120 ASP n 1 121 PRO n 1 122 GLU n 1 123 GLY n 1 124 GLN n 1 125 ILE n 1 126 ALA n 1 127 PHE n 1 128 GLN n 1 129 LEU n 1 130 GLY n 1 131 GLY n 1 132 PHE n 1 133 SER n 1 134 ALA n 1 135 ASP n 1 136 ALA n 1 137 TRP n 1 138 THR n 1 139 LEU n 1 140 CYS n 1 141 LEU n 1 142 ASP n 1 143 ASP n 1 144 VAL n 1 145 ALA n 1 146 LEU n 1 147 ASP n 1 148 SER n 1 149 GLU n 1 150 VAL n 1 151 GLU n 1 152 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Cellulomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cellulomonas fimi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1708 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM101 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PTUG _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GUNC_CELFI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P14090 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MVSRRSSQARGALTAVVATLALALAGSGTALAASPIGEGTFDDGPEGWVAYGTDGPLDTSTGALCVAVPAGSAQYGVGVV LNGVAIEEGTTYTLRYTATASTDVTVRALVGQNGAPYGTVLDTSPALTSEPRQVTETFTASATYPATPAADDPEGQIAFQ LGGFSADAWTFCLDDVALDSEVELLPHTSFAESLGPWSLYGTSEPVFADGRMCVDLPGGQGNPWDAGLVYNGVPVGEGES YVLSFTASATPDMPVRVLVGEGGGAYRTAFEQGSAPLTGEPATREYAFTSNLTFPPDGDAPGQVAFHLGKAGAYEFCISQ VSLTTSATPPPGYEPDTGPRVRVNQVGYLPFGPKRATLVTDAAEPVAWELRDADGVVVADGTSEPRGVEPSAAQAVHVLD FSDVTTQGAGYTLVADGETSRPFDIDGDLYQQLRYDALNYFYLARSGTEIEADVVGEEYAREAGHVGVAPNQGDTDVPCI GPRDYYDGWTCDYRLDVSGGWYDAGDHGKYVVNGGIAVGQLLQTYERALHAGTADALADGTLDVPEHGNDVPDVLDEARW ELEWMLSMIVPEGEYAGMVHHKVHDEGWTGLPLLPADDPQARSLHRPSTAATLNLSAVAAQGARLLEPYDPQLAQTLLEA ARTTWAAAQEHPALYAPGEAGADGGGAYNDSQVADEFYWAAAELYLTTGEDAFATAVTTSPLHTADVFTADGFGWGSVAA LGRLDLATVPNELPGLDAVQSSVVEGAQEYLAAQAGQGFGSLYSPPGGEYVWGSSSQVANNLVVVATAYDLTGDERFRAA TLEGLDYLFGRNALNQSYVTGWGEVASHQQHSRWFAHQLDPSLPSPPPGSLAGGPNSQAATWDPTTKAAFPDGCAPSACY VDEIQAWSTNELTVNWNSALSWVASWVADQGSAEPVPTAPVVTRQPVDATVALGADATFTAEASGVPAPTVRWQVRAGRG WKDVAGATGTTLTVRATARTDGTRYRAVFTNAAGSVESAVVRLTVERAAPVVTQHPADVRARVGTRAVFRAAADGYPTPC VVWQVRWGGGSWRPIPWATSTTLSVPVTVLAAGTEYRAVFTNAVGTAATEPAELAVQRPRS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ULO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14090 _struct_ref_seq.db_align_beg 33 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 184 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 152 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1ULO _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 139 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P14090 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 171 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 139 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'SEE JOURNAL PUBLICATION' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1ULO _pdbx_nmr_refine.method 'XPLOR V3.1' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1ULO _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' NMRPipe ? ? 2 'structure solution' PIPP ? ? 3 # _exptl.entry_id 1ULO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ULO _struct.title 'N-TERMINAL CELLULOSE-BINDING DOMAIN FROM CELLULOMONAS FIMI BETA-1,4-GLUCANASE C, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ULO _struct_keywords.pdbx_keywords 'CELLULOSE DEGRADATION' _struct_keywords.text 'CELLULOSE DEGRADATION, CELLULOSE-BINDING DOMAIN, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 33 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 140 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 33 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 140 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.020 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 83 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 83 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 84 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 84 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.14 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 17 ? TYR A 19 ? VAL A 17 TYR A 19 A 2 VAL A 45 ? ASN A 50 ? VAL A 45 ASN A 50 A 3 GLU A 122 ? LEU A 129 ? GLU A 122 LEU A 129 A 4 VAL A 72 ? ASN A 81 ? VAL A 72 ASN A 81 A 5 GLY A 86 ? THR A 96 ? GLY A 86 THR A 96 B 1 LEU A 25 ? THR A 27 ? LEU A 25 THR A 27 B 2 ALA A 31 ? VAL A 36 ? ALA A 31 VAL A 36 B 3 TRP A 137 ? SER A 148 ? TRP A 137 SER A 148 B 4 THR A 58 ? ALA A 68 ? THR A 58 ALA A 68 B 5 ARG A 100 ? ALA A 108 ? ARG A 100 ALA A 108 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 19 ? N TYR A 19 O GLY A 46 ? O GLY A 46 A 2 3 N VAL A 47 ? N VAL A 47 O PHE A 127 ? O PHE A 127 A 3 4 N ALA A 126 ? N ALA A 126 O LEU A 77 ? O LEU A 77 A 4 5 N ALA A 76 ? N ALA A 76 O THR A 91 ? O THR A 91 B 1 2 N ASP A 26 ? N ASP A 26 O CYS A 33 ? O CYS A 33 B 2 3 N VAL A 34 ? N VAL A 34 O LEU A 139 ? O LEU A 139 B 3 4 N ALA A 145 ? N ALA A 145 O ARG A 63 ? O ARG A 63 B 4 5 N LEU A 62 ? N LEU A 62 O GLU A 104 ? O GLU A 104 # _database_PDB_matrix.entry_id 1ULO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ULO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 CYS 140 140 140 CYS CYS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LEU 152 152 152 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-04-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -76.40 -156.68 2 1 GLU A 6 ? ? -42.08 95.07 3 1 THR A 8 ? ? -92.93 -141.92 4 1 ASP A 10 ? ? -84.35 45.81 5 1 ASP A 11 ? ? 161.67 44.08 6 1 GLU A 14 ? ? 63.07 -90.53 7 1 THR A 21 ? ? -148.28 -156.65 8 1 PRO A 24 ? ? -74.26 -158.47 9 1 THR A 27 ? ? -124.55 -83.58 10 1 SER A 28 ? ? 35.51 54.12 11 1 THR A 29 ? ? -177.74 -34.37 12 1 SER A 40 ? ? 25.32 56.69 13 1 GLN A 42 ? ? 171.27 -157.98 14 1 GLU A 56 ? ? 36.75 -154.43 15 1 VAL A 74 ? ? -91.19 -148.48 16 1 LEU A 77 ? ? 179.82 -149.53 17 1 ALA A 83 ? ? -49.46 157.22 18 1 TYR A 85 ? ? 61.30 153.26 19 1 ASP A 90 ? ? -152.02 80.28 20 1 ALA A 108 ? ? -57.11 104.08 21 1 SER A 109 ? ? -92.16 52.44 22 1 ALA A 110 ? ? -158.91 -156.13 23 1 PRO A 121 ? ? -73.72 -159.75 24 1 GLU A 122 ? ? -154.46 -140.31 25 1 GLN A 124 ? ? -150.35 -157.88 26 1 PHE A 132 ? ? -145.61 -61.73 27 1 ALA A 134 ? ? -94.85 -85.10 28 1 TRP A 137 ? ? -141.99 -159.15 29 1 ASP A 142 ? ? 171.04 46.34 30 1 ASP A 143 ? ? 169.69 70.20 31 1 GLU A 149 ? ? -62.08 94.27 #