data_1UND # _entry.id 1UND # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UND pdb_00001und 10.2210/pdb1und/pdb PDBE EBI-13460 ? ? WWPDB D_1290013460 ? ? BMRB 5966 ? 10.13018/BMR5966 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-07-15 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_nmr_spectrometer 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UND _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-09-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 5966 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vermeulen, W.' 1 'Van Troys, M.' 2 'Vanhaesebrouck, P.' 3 'Verschueren, M.' 4 'Fant, F.' 5 'Ampe, C.' 6 'Martins, J.' 7 'Borremans, F.' 8 # _citation.id primary _citation.title ;Solution Structures of the C-Terminal Headpiece Subdomains of Human Villin and Advillin, Evaluation of Headpiece F-Actin-Binding Requirements ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 13 _citation.page_first 1276 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15096633 _citation.pdbx_database_id_DOI 10.1110/PS.03518104 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vermeulen, W.' 1 ? primary 'Vanhaesebrouck, P.' 2 ? primary 'Van Troys, M.' 3 ? primary 'Verschueren, M.' 4 ? primary 'Fant, F.' 5 ? primary 'Goethals, M.' 6 ? primary 'Ampe, C.' 7 ? primary 'Martins, J.' 8 ? primary 'Borremans, F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description ADVILLIN _entity.formula_weight 4179.858 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HEADPIECE C-TERMINAL SUBDOMAIN, RESIDUES 784-819' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name P92 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)YLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF' _entity_poly.pdbx_seq_one_letter_code_can XYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 TYR n 1 3 LEU n 1 4 SER n 1 5 GLU n 1 6 GLN n 1 7 ASP n 1 8 PHE n 1 9 VAL n 1 10 SER n 1 11 VAL n 1 12 PHE n 1 13 GLY n 1 14 ILE n 1 15 THR n 1 16 ARG n 1 17 GLY n 1 18 GLN n 1 19 PHE n 1 20 ALA n 1 21 ALA n 1 22 LEU n 1 23 PRO n 1 24 GLY n 1 25 TRP n 1 26 LYS n 1 27 GLN n 1 28 LEU n 1 29 GLN n 1 30 MET n 1 31 LYS n 1 32 LYS n 1 33 GLU n 1 34 LYS n 1 35 GLY n 1 36 LEU n 1 37 PHE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'HOMO SAPIENS' _pdbx_entity_src_syn.organism_common_name HUMAN _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 TYR 2 1 1 TYR TYR A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLN 6 5 5 GLN GLN A . n A 1 7 ASP 7 6 6 ASP ASP A . n A 1 8 PHE 8 7 7 PHE PHE A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 SER 10 9 9 SER SER A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 PHE 12 11 11 PHE PHE A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 ILE 14 13 13 ILE ILE A . n A 1 15 THR 15 14 14 THR THR A . n A 1 16 ARG 16 15 15 ARG ARG A . n A 1 17 GLY 17 16 16 GLY GLY A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 PHE 19 18 18 PHE PHE A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 PRO 23 22 22 PRO PRO A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 TRP 25 24 24 TRP TRP A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 GLN 29 28 28 GLN GLN A . n A 1 30 MET 30 29 29 MET MET A . n A 1 31 LYS 31 30 30 LYS LYS A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 GLY 35 34 34 GLY GLY A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 PHE 37 36 36 PHE PHE A . n # _cell.entry_id 1UND _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UND _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1UND _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1UND _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1UND _struct.title 'Solution structure of the human advillin C-terminal headpiece subdomain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UND _struct_keywords.pdbx_keywords 'ACTIN BINDING' _struct_keywords.text 'ACTIN BINDING, F-ACTIN BINDING, CYTOSKELETON, HEADPIECE SUBDOMAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1UND 1 ? ? 1UND ? 2 UNP ADVL_HUMAN 1 ? ? O75366 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1UND A 1 ? 1 ? 1UND 0 ? 0 ? 0 0 2 2 1UND A 2 ? 37 ? O75366 784 ? 819 ? 1 36 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? GLY A 13 ? SER A 3 GLY A 12 1 ? 10 HELX_P HELX_P2 2 THR A 15 ? LEU A 22 ? THR A 14 LEU A 21 1 ? 8 HELX_P HELX_P3 3 PRO A 23 ? LEU A 36 ? PRO A 22 LEU A 35 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ACE _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id TYR _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ACE _struct_conn.ptnr1_auth_seq_id 0 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id TYR _struct_conn.ptnr2_auth_seq_id 1 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.338 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ACE _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id TYR _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 2 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id ACE _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 0 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id TYR _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 1 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id TYR _pdbx_modification_feature.ref_pcm_id 5 _pdbx_modification_feature.ref_comp_id ACE _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal acetylation' # _pdbx_entry_details.entry_id 1UND _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.364 1.252 0.112 0.011 N 2 1 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 3 2 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 4 2 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.365 1.252 0.113 0.011 N 5 3 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 6 3 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 7 4 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 8 4 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 9 5 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 10 5 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 11 6 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.365 1.252 0.113 0.011 N 12 6 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.365 1.252 0.113 0.011 N 13 7 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.364 1.252 0.112 0.011 N 14 7 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.365 1.252 0.113 0.011 N 15 8 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 16 8 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.364 1.252 0.112 0.011 N 17 9 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.364 1.252 0.112 0.011 N 18 9 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.362 1.252 0.110 0.011 N 19 10 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.365 1.252 0.113 0.011 N 20 10 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 21 11 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.364 1.252 0.112 0.011 N 22 11 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 23 12 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.366 1.252 0.114 0.011 N 24 12 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.362 1.252 0.110 0.011 N 25 13 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.366 1.252 0.114 0.011 N 26 13 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.364 1.252 0.112 0.011 N 27 14 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 28 14 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.364 1.252 0.112 0.011 N 29 15 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.364 1.252 0.112 0.011 N 30 15 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 31 16 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.364 1.252 0.112 0.011 N 32 16 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.364 1.252 0.112 0.011 N 33 17 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.362 1.252 0.110 0.011 N 34 17 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 35 18 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.364 1.252 0.112 0.011 N 36 18 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.364 1.252 0.112 0.011 N 37 19 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 38 19 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 39 20 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 40 20 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.363 1.252 0.111 0.011 N 41 21 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 42 21 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.364 1.252 0.112 0.011 N 43 22 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.366 1.252 0.114 0.011 N 44 22 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.362 1.252 0.110 0.011 N 45 23 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 46 23 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.365 1.252 0.113 0.011 N 47 24 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.365 1.252 0.113 0.011 N 48 24 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.364 1.252 0.112 0.011 N 49 25 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 50 25 CD A GLU 32 ? ? OE2 A GLU 32 ? ? 1.362 1.252 0.110 0.011 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? -172.70 130.56 2 1 LEU A 35 ? ? -164.28 31.26 3 2 SER A 3 ? ? -47.85 151.45 4 2 LEU A 35 ? ? -158.49 28.78 5 3 SER A 3 ? ? -49.62 154.97 6 3 LEU A 35 ? ? -159.30 36.17 7 4 LEU A 2 ? ? -175.09 130.28 8 4 LEU A 35 ? ? -165.16 29.82 9 5 LEU A 2 ? ? -174.24 130.68 10 5 LEU A 35 ? ? -156.16 41.80 11 6 LEU A 2 ? ? -170.03 130.58 12 6 LEU A 35 ? ? -166.14 24.85 13 7 LEU A 2 ? ? 52.88 85.61 14 7 LEU A 35 ? ? -93.43 42.35 15 8 LEU A 35 ? ? -158.00 24.91 16 9 LEU A 2 ? ? -172.29 129.96 17 9 LEU A 35 ? ? -162.47 27.97 18 10 ILE A 13 ? ? -110.46 -160.08 19 10 LEU A 35 ? ? -164.47 24.53 20 11 LEU A 2 ? ? -174.70 130.08 21 11 LEU A 35 ? ? -166.72 26.96 22 12 LEU A 2 ? ? 55.25 85.19 23 12 LEU A 35 ? ? -159.79 42.35 24 13 LEU A 2 ? ? 59.28 94.41 25 13 LEU A 35 ? ? -167.35 24.64 26 14 LEU A 2 ? ? 58.96 93.03 27 14 LEU A 35 ? ? -157.87 41.23 28 15 LEU A 2 ? ? -174.21 129.81 29 15 LEU A 35 ? ? -170.55 27.76 30 16 LEU A 2 ? ? 55.08 78.22 31 16 LEU A 35 ? ? -166.37 28.98 32 17 LEU A 2 ? ? -161.15 117.53 33 17 LEU A 35 ? ? -160.16 29.28 34 18 LEU A 35 ? ? -160.63 29.12 35 19 LEU A 2 ? ? -175.06 130.34 36 19 LEU A 35 ? ? -158.42 28.10 37 20 LEU A 2 ? ? 54.64 82.11 38 21 LEU A 2 ? ? 54.20 83.80 39 21 LEU A 35 ? ? -163.19 24.84 40 22 LEU A 2 ? ? -173.95 130.87 41 22 LEU A 35 ? ? -166.52 35.02 42 23 LEU A 2 ? ? 60.61 108.07 43 23 LEU A 35 ? ? -153.42 43.10 44 24 LEU A 2 ? ? -176.15 130.71 45 24 LEU A 35 ? ? -156.53 24.11 46 25 LEU A 2 ? ? -170.29 129.66 47 25 SER A 3 ? ? -39.56 139.69 48 25 LEU A 35 ? ? -159.44 40.64 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 1 ? ? 0.073 'SIDE CHAIN' 2 2 PHE A 7 ? ? 0.092 'SIDE CHAIN' 3 4 TYR A 1 ? ? 0.082 'SIDE CHAIN' 4 5 PHE A 7 ? ? 0.081 'SIDE CHAIN' 5 8 PHE A 7 ? ? 0.089 'SIDE CHAIN' 6 9 TYR A 1 ? ? 0.085 'SIDE CHAIN' 7 9 PHE A 7 ? ? 0.079 'SIDE CHAIN' 8 11 TYR A 1 ? ? 0.076 'SIDE CHAIN' 9 11 PHE A 7 ? ? 0.085 'SIDE CHAIN' 10 12 PHE A 7 ? ? 0.086 'SIDE CHAIN' 11 14 PHE A 7 ? ? 0.102 'SIDE CHAIN' 12 15 TYR A 1 ? ? 0.083 'SIDE CHAIN' 13 19 TYR A 1 ? ? 0.076 'SIDE CHAIN' 14 21 PHE A 7 ? ? 0.078 'SIDE CHAIN' 15 23 PHE A 7 ? ? 0.111 'SIDE CHAIN' 16 24 PHE A 7 ? ? 0.079 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1UND _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 294 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 DQF-COSY 1 4 1 E.COSY 1 # _pdbx_nmr_details.entry_id 1UND _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING 2D-1H NMR' # _pdbx_nmr_refine.entry_id 1UND _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'SIMULATED ANNEALING IN THE AMBER FORCEFIELD' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement 'Insight II' ? ACCELRYS 1 'structure solution' DYANA ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASP N N N N 48 ASP CA C N S 49 ASP C C N N 50 ASP O O N N 51 ASP CB C N N 52 ASP CG C N N 53 ASP OD1 O N N 54 ASP OD2 O N N 55 ASP OXT O N N 56 ASP H H N N 57 ASP H2 H N N 58 ASP HA H N N 59 ASP HB2 H N N 60 ASP HB3 H N N 61 ASP HD2 H N N 62 ASP HXT H N N 63 GLN N N N N 64 GLN CA C N S 65 GLN C C N N 66 GLN O O N N 67 GLN CB C N N 68 GLN CG C N N 69 GLN CD C N N 70 GLN OE1 O N N 71 GLN NE2 N N N 72 GLN OXT O N N 73 GLN H H N N 74 GLN H2 H N N 75 GLN HA H N N 76 GLN HB2 H N N 77 GLN HB3 H N N 78 GLN HG2 H N N 79 GLN HG3 H N N 80 GLN HE21 H N N 81 GLN HE22 H N N 82 GLN HXT H N N 83 GLU N N N N 84 GLU CA C N S 85 GLU C C N N 86 GLU O O N N 87 GLU CB C N N 88 GLU CG C N N 89 GLU CD C N N 90 GLU OE1 O N N 91 GLU OE2 O N N 92 GLU OXT O N N 93 GLU H H N N 94 GLU H2 H N N 95 GLU HA H N N 96 GLU HB2 H N N 97 GLU HB3 H N N 98 GLU HG2 H N N 99 GLU HG3 H N N 100 GLU HE2 H N N 101 GLU HXT H N N 102 GLY N N N N 103 GLY CA C N N 104 GLY C C N N 105 GLY O O N N 106 GLY OXT O N N 107 GLY H H N N 108 GLY H2 H N N 109 GLY HA2 H N N 110 GLY HA3 H N N 111 GLY HXT H N N 112 ILE N N N N 113 ILE CA C N S 114 ILE C C N N 115 ILE O O N N 116 ILE CB C N S 117 ILE CG1 C N N 118 ILE CG2 C N N 119 ILE CD1 C N N 120 ILE OXT O N N 121 ILE H H N N 122 ILE H2 H N N 123 ILE HA H N N 124 ILE HB H N N 125 ILE HG12 H N N 126 ILE HG13 H N N 127 ILE HG21 H N N 128 ILE HG22 H N N 129 ILE HG23 H N N 130 ILE HD11 H N N 131 ILE HD12 H N N 132 ILE HD13 H N N 133 ILE HXT H N N 134 LEU N N N N 135 LEU CA C N S 136 LEU C C N N 137 LEU O O N N 138 LEU CB C N N 139 LEU CG C N N 140 LEU CD1 C N N 141 LEU CD2 C N N 142 LEU OXT O N N 143 LEU H H N N 144 LEU H2 H N N 145 LEU HA H N N 146 LEU HB2 H N N 147 LEU HB3 H N N 148 LEU HG H N N 149 LEU HD11 H N N 150 LEU HD12 H N N 151 LEU HD13 H N N 152 LEU HD21 H N N 153 LEU HD22 H N N 154 LEU HD23 H N N 155 LEU HXT H N N 156 LYS N N N N 157 LYS CA C N S 158 LYS C C N N 159 LYS O O N N 160 LYS CB C N N 161 LYS CG C N N 162 LYS CD C N N 163 LYS CE C N N 164 LYS NZ N N N 165 LYS OXT O N N 166 LYS H H N N 167 LYS H2 H N N 168 LYS HA H N N 169 LYS HB2 H N N 170 LYS HB3 H N N 171 LYS HG2 H N N 172 LYS HG3 H N N 173 LYS HD2 H N N 174 LYS HD3 H N N 175 LYS HE2 H N N 176 LYS HE3 H N N 177 LYS HZ1 H N N 178 LYS HZ2 H N N 179 LYS HZ3 H N N 180 LYS HXT H N N 181 MET N N N N 182 MET CA C N S 183 MET C C N N 184 MET O O N N 185 MET CB C N N 186 MET CG C N N 187 MET SD S N N 188 MET CE C N N 189 MET OXT O N N 190 MET H H N N 191 MET H2 H N N 192 MET HA H N N 193 MET HB2 H N N 194 MET HB3 H N N 195 MET HG2 H N N 196 MET HG3 H N N 197 MET HE1 H N N 198 MET HE2 H N N 199 MET HE3 H N N 200 MET HXT H N N 201 PHE N N N N 202 PHE CA C N S 203 PHE C C N N 204 PHE O O N N 205 PHE CB C N N 206 PHE CG C Y N 207 PHE CD1 C Y N 208 PHE CD2 C Y N 209 PHE CE1 C Y N 210 PHE CE2 C Y N 211 PHE CZ C Y N 212 PHE OXT O N N 213 PHE H H N N 214 PHE H2 H N N 215 PHE HA H N N 216 PHE HB2 H N N 217 PHE HB3 H N N 218 PHE HD1 H N N 219 PHE HD2 H N N 220 PHE HE1 H N N 221 PHE HE2 H N N 222 PHE HZ H N N 223 PHE HXT H N N 224 PRO N N N N 225 PRO CA C N S 226 PRO C C N N 227 PRO O O N N 228 PRO CB C N N 229 PRO CG C N N 230 PRO CD C N N 231 PRO OXT O N N 232 PRO H H N N 233 PRO HA H N N 234 PRO HB2 H N N 235 PRO HB3 H N N 236 PRO HG2 H N N 237 PRO HG3 H N N 238 PRO HD2 H N N 239 PRO HD3 H N N 240 PRO HXT H N N 241 SER N N N N 242 SER CA C N S 243 SER C C N N 244 SER O O N N 245 SER CB C N N 246 SER OG O N N 247 SER OXT O N N 248 SER H H N N 249 SER H2 H N N 250 SER HA H N N 251 SER HB2 H N N 252 SER HB3 H N N 253 SER HG H N N 254 SER HXT H N N 255 THR N N N N 256 THR CA C N S 257 THR C C N N 258 THR O O N N 259 THR CB C N R 260 THR OG1 O N N 261 THR CG2 C N N 262 THR OXT O N N 263 THR H H N N 264 THR H2 H N N 265 THR HA H N N 266 THR HB H N N 267 THR HG1 H N N 268 THR HG21 H N N 269 THR HG22 H N N 270 THR HG23 H N N 271 THR HXT H N N 272 TRP N N N N 273 TRP CA C N S 274 TRP C C N N 275 TRP O O N N 276 TRP CB C N N 277 TRP CG C Y N 278 TRP CD1 C Y N 279 TRP CD2 C Y N 280 TRP NE1 N Y N 281 TRP CE2 C Y N 282 TRP CE3 C Y N 283 TRP CZ2 C Y N 284 TRP CZ3 C Y N 285 TRP CH2 C Y N 286 TRP OXT O N N 287 TRP H H N N 288 TRP H2 H N N 289 TRP HA H N N 290 TRP HB2 H N N 291 TRP HB3 H N N 292 TRP HD1 H N N 293 TRP HE1 H N N 294 TRP HE3 H N N 295 TRP HZ2 H N N 296 TRP HZ3 H N N 297 TRP HH2 H N N 298 TRP HXT H N N 299 TYR N N N N 300 TYR CA C N S 301 TYR C C N N 302 TYR O O N N 303 TYR CB C N N 304 TYR CG C Y N 305 TYR CD1 C Y N 306 TYR CD2 C Y N 307 TYR CE1 C Y N 308 TYR CE2 C Y N 309 TYR CZ C Y N 310 TYR OH O N N 311 TYR OXT O N N 312 TYR H H N N 313 TYR H2 H N N 314 TYR HA H N N 315 TYR HB2 H N N 316 TYR HB3 H N N 317 TYR HD1 H N N 318 TYR HD2 H N N 319 TYR HE1 H N N 320 TYR HE2 H N N 321 TYR HH H N N 322 TYR HXT H N N 323 VAL N N N N 324 VAL CA C N S 325 VAL C C N N 326 VAL O O N N 327 VAL CB C N N 328 VAL CG1 C N N 329 VAL CG2 C N N 330 VAL OXT O N N 331 VAL H H N N 332 VAL H2 H N N 333 VAL HA H N N 334 VAL HB H N N 335 VAL HG11 H N N 336 VAL HG12 H N N 337 VAL HG13 H N N 338 VAL HG21 H N N 339 VAL HG22 H N N 340 VAL HG23 H N N 341 VAL HXT H N N 342 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASP N CA sing N N 45 ASP N H sing N N 46 ASP N H2 sing N N 47 ASP CA C sing N N 48 ASP CA CB sing N N 49 ASP CA HA sing N N 50 ASP C O doub N N 51 ASP C OXT sing N N 52 ASP CB CG sing N N 53 ASP CB HB2 sing N N 54 ASP CB HB3 sing N N 55 ASP CG OD1 doub N N 56 ASP CG OD2 sing N N 57 ASP OD2 HD2 sing N N 58 ASP OXT HXT sing N N 59 GLN N CA sing N N 60 GLN N H sing N N 61 GLN N H2 sing N N 62 GLN CA C sing N N 63 GLN CA CB sing N N 64 GLN CA HA sing N N 65 GLN C O doub N N 66 GLN C OXT sing N N 67 GLN CB CG sing N N 68 GLN CB HB2 sing N N 69 GLN CB HB3 sing N N 70 GLN CG CD sing N N 71 GLN CG HG2 sing N N 72 GLN CG HG3 sing N N 73 GLN CD OE1 doub N N 74 GLN CD NE2 sing N N 75 GLN NE2 HE21 sing N N 76 GLN NE2 HE22 sing N N 77 GLN OXT HXT sing N N 78 GLU N CA sing N N 79 GLU N H sing N N 80 GLU N H2 sing N N 81 GLU CA C sing N N 82 GLU CA CB sing N N 83 GLU CA HA sing N N 84 GLU C O doub N N 85 GLU C OXT sing N N 86 GLU CB CG sing N N 87 GLU CB HB2 sing N N 88 GLU CB HB3 sing N N 89 GLU CG CD sing N N 90 GLU CG HG2 sing N N 91 GLU CG HG3 sing N N 92 GLU CD OE1 doub N N 93 GLU CD OE2 sing N N 94 GLU OE2 HE2 sing N N 95 GLU OXT HXT sing N N 96 GLY N CA sing N N 97 GLY N H sing N N 98 GLY N H2 sing N N 99 GLY CA C sing N N 100 GLY CA HA2 sing N N 101 GLY CA HA3 sing N N 102 GLY C O doub N N 103 GLY C OXT sing N N 104 GLY OXT HXT sing N N 105 ILE N CA sing N N 106 ILE N H sing N N 107 ILE N H2 sing N N 108 ILE CA C sing N N 109 ILE CA CB sing N N 110 ILE CA HA sing N N 111 ILE C O doub N N 112 ILE C OXT sing N N 113 ILE CB CG1 sing N N 114 ILE CB CG2 sing N N 115 ILE CB HB sing N N 116 ILE CG1 CD1 sing N N 117 ILE CG1 HG12 sing N N 118 ILE CG1 HG13 sing N N 119 ILE CG2 HG21 sing N N 120 ILE CG2 HG22 sing N N 121 ILE CG2 HG23 sing N N 122 ILE CD1 HD11 sing N N 123 ILE CD1 HD12 sing N N 124 ILE CD1 HD13 sing N N 125 ILE OXT HXT sing N N 126 LEU N CA sing N N 127 LEU N H sing N N 128 LEU N H2 sing N N 129 LEU CA C sing N N 130 LEU CA CB sing N N 131 LEU CA HA sing N N 132 LEU C O doub N N 133 LEU C OXT sing N N 134 LEU CB CG sing N N 135 LEU CB HB2 sing N N 136 LEU CB HB3 sing N N 137 LEU CG CD1 sing N N 138 LEU CG CD2 sing N N 139 LEU CG HG sing N N 140 LEU CD1 HD11 sing N N 141 LEU CD1 HD12 sing N N 142 LEU CD1 HD13 sing N N 143 LEU CD2 HD21 sing N N 144 LEU CD2 HD22 sing N N 145 LEU CD2 HD23 sing N N 146 LEU OXT HXT sing N N 147 LYS N CA sing N N 148 LYS N H sing N N 149 LYS N H2 sing N N 150 LYS CA C sing N N 151 LYS CA CB sing N N 152 LYS CA HA sing N N 153 LYS C O doub N N 154 LYS C OXT sing N N 155 LYS CB CG sing N N 156 LYS CB HB2 sing N N 157 LYS CB HB3 sing N N 158 LYS CG CD sing N N 159 LYS CG HG2 sing N N 160 LYS CG HG3 sing N N 161 LYS CD CE sing N N 162 LYS CD HD2 sing N N 163 LYS CD HD3 sing N N 164 LYS CE NZ sing N N 165 LYS CE HE2 sing N N 166 LYS CE HE3 sing N N 167 LYS NZ HZ1 sing N N 168 LYS NZ HZ2 sing N N 169 LYS NZ HZ3 sing N N 170 LYS OXT HXT sing N N 171 MET N CA sing N N 172 MET N H sing N N 173 MET N H2 sing N N 174 MET CA C sing N N 175 MET CA CB sing N N 176 MET CA HA sing N N 177 MET C O doub N N 178 MET C OXT sing N N 179 MET CB CG sing N N 180 MET CB HB2 sing N N 181 MET CB HB3 sing N N 182 MET CG SD sing N N 183 MET CG HG2 sing N N 184 MET CG HG3 sing N N 185 MET SD CE sing N N 186 MET CE HE1 sing N N 187 MET CE HE2 sing N N 188 MET CE HE3 sing N N 189 MET OXT HXT sing N N 190 PHE N CA sing N N 191 PHE N H sing N N 192 PHE N H2 sing N N 193 PHE CA C sing N N 194 PHE CA CB sing N N 195 PHE CA HA sing N N 196 PHE C O doub N N 197 PHE C OXT sing N N 198 PHE CB CG sing N N 199 PHE CB HB2 sing N N 200 PHE CB HB3 sing N N 201 PHE CG CD1 doub Y N 202 PHE CG CD2 sing Y N 203 PHE CD1 CE1 sing Y N 204 PHE CD1 HD1 sing N N 205 PHE CD2 CE2 doub Y N 206 PHE CD2 HD2 sing N N 207 PHE CE1 CZ doub Y N 208 PHE CE1 HE1 sing N N 209 PHE CE2 CZ sing Y N 210 PHE CE2 HE2 sing N N 211 PHE CZ HZ sing N N 212 PHE OXT HXT sing N N 213 PRO N CA sing N N 214 PRO N CD sing N N 215 PRO N H sing N N 216 PRO CA C sing N N 217 PRO CA CB sing N N 218 PRO CA HA sing N N 219 PRO C O doub N N 220 PRO C OXT sing N N 221 PRO CB CG sing N N 222 PRO CB HB2 sing N N 223 PRO CB HB3 sing N N 224 PRO CG CD sing N N 225 PRO CG HG2 sing N N 226 PRO CG HG3 sing N N 227 PRO CD HD2 sing N N 228 PRO CD HD3 sing N N 229 PRO OXT HXT sing N N 230 SER N CA sing N N 231 SER N H sing N N 232 SER N H2 sing N N 233 SER CA C sing N N 234 SER CA CB sing N N 235 SER CA HA sing N N 236 SER C O doub N N 237 SER C OXT sing N N 238 SER CB OG sing N N 239 SER CB HB2 sing N N 240 SER CB HB3 sing N N 241 SER OG HG sing N N 242 SER OXT HXT sing N N 243 THR N CA sing N N 244 THR N H sing N N 245 THR N H2 sing N N 246 THR CA C sing N N 247 THR CA CB sing N N 248 THR CA HA sing N N 249 THR C O doub N N 250 THR C OXT sing N N 251 THR CB OG1 sing N N 252 THR CB CG2 sing N N 253 THR CB HB sing N N 254 THR OG1 HG1 sing N N 255 THR CG2 HG21 sing N N 256 THR CG2 HG22 sing N N 257 THR CG2 HG23 sing N N 258 THR OXT HXT sing N N 259 TRP N CA sing N N 260 TRP N H sing N N 261 TRP N H2 sing N N 262 TRP CA C sing N N 263 TRP CA CB sing N N 264 TRP CA HA sing N N 265 TRP C O doub N N 266 TRP C OXT sing N N 267 TRP CB CG sing N N 268 TRP CB HB2 sing N N 269 TRP CB HB3 sing N N 270 TRP CG CD1 doub Y N 271 TRP CG CD2 sing Y N 272 TRP CD1 NE1 sing Y N 273 TRP CD1 HD1 sing N N 274 TRP CD2 CE2 doub Y N 275 TRP CD2 CE3 sing Y N 276 TRP NE1 CE2 sing Y N 277 TRP NE1 HE1 sing N N 278 TRP CE2 CZ2 sing Y N 279 TRP CE3 CZ3 doub Y N 280 TRP CE3 HE3 sing N N 281 TRP CZ2 CH2 doub Y N 282 TRP CZ2 HZ2 sing N N 283 TRP CZ3 CH2 sing Y N 284 TRP CZ3 HZ3 sing N N 285 TRP CH2 HH2 sing N N 286 TRP OXT HXT sing N N 287 TYR N CA sing N N 288 TYR N H sing N N 289 TYR N H2 sing N N 290 TYR CA C sing N N 291 TYR CA CB sing N N 292 TYR CA HA sing N N 293 TYR C O doub N N 294 TYR C OXT sing N N 295 TYR CB CG sing N N 296 TYR CB HB2 sing N N 297 TYR CB HB3 sing N N 298 TYR CG CD1 doub Y N 299 TYR CG CD2 sing Y N 300 TYR CD1 CE1 sing Y N 301 TYR CD1 HD1 sing N N 302 TYR CD2 CE2 doub Y N 303 TYR CD2 HD2 sing N N 304 TYR CE1 CZ doub Y N 305 TYR CE1 HE1 sing N N 306 TYR CE2 CZ sing Y N 307 TYR CE2 HE2 sing N N 308 TYR CZ OH sing N N 309 TYR OH HH sing N N 310 TYR OXT HXT sing N N 311 VAL N CA sing N N 312 VAL N H sing N N 313 VAL N H2 sing N N 314 VAL CA C sing N N 315 VAL CA CB sing N N 316 VAL CA HA sing N N 317 VAL C O doub N N 318 VAL C OXT sing N N 319 VAL CB CG1 sing N N 320 VAL CB CG2 sing N N 321 VAL CB HB sing N N 322 VAL CG1 HG11 sing N N 323 VAL CG1 HG12 sing N N 324 VAL CG1 HG13 sing N N 325 VAL CG2 HG21 sing N N 326 VAL CG2 HG22 sing N N 327 VAL CG2 HG23 sing N N 328 VAL OXT HXT sing N N 329 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1UND _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_