data_1UTM # _entry.id 1UTM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UTM PDBE EBI-14168 WWPDB D_1290014168 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1BIT unspecified 'TRYPSIN (ANIONIC) COMPLEXED WITH THE INHIBITOR BENZAMIDINE' PDB 1BZX unspecified 'THE CRYSTAL STRUCTURE OF ANIONIC SALMON TRYPSIN IN COMPLEX WITH BOVINE PANCREATIC TRYPSIN INHIBITOR' PDB 1HJ8 unspecified '1.00 AA TRYPSIN FROM ATLANTIC SALMON' PDB 1UTJ unspecified 'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X-RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' PDB 1UTK unspecified 'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X-RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' PDB 1UTL unspecified 'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X-RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' PDB 1UTN unspecified 'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X-RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' PDB 1UTO unspecified 'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X-RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' PDB 1UTP unspecified 'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X-RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' PDB 1UTQ unspecified 'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X-RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' PDB 2STA unspecified 'ANIONIC SALMON TRYPSIN IN COMPLEX WITH SQUASH SEED INHIBITOR (CUCURBITA MAXIMA TRYPSIN INHIBITOR I)' PDB 2STB unspecified 'ANIONIC SALMON TRYPSIN IN COMPLEX WITH SQUASH SEED INHIBITOR (CUCURBITA PEPO TRYPSIN INHIBITOR II)' PDB 2TBS unspecified 'TRYPSIN COMPLEXED WITH BENZAMIDINE INHIBITOR' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UTM _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-12-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Leiros, H.-K.S.' 1 'Brandsdal, B.O.' 2 'Andersen, O.A.' 3 'Os, V.' 4 'Leiros, I.' 5 'Helland, R.' 6 'Otlewski, J.' 7 'Willassen, N.P.' 8 'Smalas, A.O.' 9 # _citation.id primary _citation.title 'Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 13 _citation.page_first 1056 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15044735 _citation.pdbx_database_id_DOI 10.1110/PS.03498604 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Leiros, H.-K.S.' 1 ? primary 'Brandsdal, B.O.' 2 ? primary 'Andersen, O.A.' 3 ? primary 'Os, V.' 4 ? primary 'Leiros, I.' 5 ? primary 'Helland, R.' 6 ? primary 'Otlewski, J.' 7 ? primary 'Willassen, N.P.' 8 ? primary 'Smalas, A.O.' 9 ? # _cell.entry_id 1UTM _cell.length_a 74.941 _cell.length_b 85.085 _cell.length_c 32.185 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UTM _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'TRYPSIN I' 25998.297 1 3.4.21.4 ? ? ? 2 non-polymer syn 2-PHENYLETHYLAMINE 122.188 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 109 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MISLVFVLLIGAAFATEDDKIVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEG SEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIP ILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA SY ; _entity_poly.pdbx_seq_one_letter_code_can ;MISLVFVLLIGAAFATEDDKIVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEG SEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIP ILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA SY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 SER n 1 4 LEU n 1 5 VAL n 1 6 PHE n 1 7 VAL n 1 8 LEU n 1 9 LEU n 1 10 ILE n 1 11 GLY n 1 12 ALA n 1 13 ALA n 1 14 PHE n 1 15 ALA n 1 16 THR n 1 17 GLU n 1 18 ASP n 1 19 ASP n 1 20 LYS n 1 21 ILE n 1 22 VAL n 1 23 GLY n 1 24 GLY n 1 25 TYR n 1 26 GLU n 1 27 CYS n 1 28 LYS n 1 29 PRO n 1 30 TYR n 1 31 SER n 1 32 GLN n 1 33 PRO n 1 34 HIS n 1 35 GLN n 1 36 VAL n 1 37 SER n 1 38 LEU n 1 39 ASN n 1 40 SER n 1 41 GLY n 1 42 TYR n 1 43 HIS n 1 44 PHE n 1 45 CYS n 1 46 GLY n 1 47 GLY n 1 48 SER n 1 49 LEU n 1 50 VAL n 1 51 ASN n 1 52 GLU n 1 53 ASN n 1 54 TRP n 1 55 VAL n 1 56 VAL n 1 57 SER n 1 58 ALA n 1 59 ALA n 1 60 HIS n 1 61 CYS n 1 62 TYR n 1 63 LYS n 1 64 SER n 1 65 ARG n 1 66 VAL n 1 67 GLU n 1 68 VAL n 1 69 ARG n 1 70 LEU n 1 71 GLY n 1 72 GLU n 1 73 HIS n 1 74 ASN n 1 75 ILE n 1 76 LYS n 1 77 VAL n 1 78 THR n 1 79 GLU n 1 80 GLY n 1 81 SER n 1 82 GLU n 1 83 GLN n 1 84 PHE n 1 85 ILE n 1 86 SER n 1 87 SER n 1 88 SER n 1 89 ARG n 1 90 VAL n 1 91 ILE n 1 92 ARG n 1 93 HIS n 1 94 PRO n 1 95 ASN n 1 96 TYR n 1 97 SER n 1 98 SER n 1 99 TYR n 1 100 ASN n 1 101 ILE n 1 102 ASP n 1 103 ASN n 1 104 ASP n 1 105 ILE n 1 106 MET n 1 107 LEU n 1 108 ILE n 1 109 LYS n 1 110 LEU n 1 111 SER n 1 112 LYS n 1 113 PRO n 1 114 ALA n 1 115 THR n 1 116 LEU n 1 117 ASN n 1 118 THR n 1 119 TYR n 1 120 VAL n 1 121 GLN n 1 122 PRO n 1 123 VAL n 1 124 ALA n 1 125 LEU n 1 126 PRO n 1 127 THR n 1 128 SER n 1 129 CYS n 1 130 ALA n 1 131 PRO n 1 132 ALA n 1 133 GLY n 1 134 THR n 1 135 MET n 1 136 CYS n 1 137 THR n 1 138 VAL n 1 139 SER n 1 140 GLY n 1 141 TRP n 1 142 GLY n 1 143 ASN n 1 144 THR n 1 145 MET n 1 146 SER n 1 147 SER n 1 148 THR n 1 149 ALA n 1 150 ASP n 1 151 SER n 1 152 ASN n 1 153 LYS n 1 154 LEU n 1 155 GLN n 1 156 CYS n 1 157 LEU n 1 158 ASN n 1 159 ILE n 1 160 PRO n 1 161 ILE n 1 162 LEU n 1 163 SER n 1 164 TYR n 1 165 SER n 1 166 ASP n 1 167 CYS n 1 168 ASN n 1 169 ASN n 1 170 SER n 1 171 TYR n 1 172 PRO n 1 173 GLY n 1 174 MET n 1 175 ILE n 1 176 THR n 1 177 ASN n 1 178 ALA n 1 179 MET n 1 180 PHE n 1 181 CYS n 1 182 ALA n 1 183 GLY n 1 184 TYR n 1 185 LEU n 1 186 GLU n 1 187 GLY n 1 188 GLY n 1 189 LYS n 1 190 ASP n 1 191 SER n 1 192 CYS n 1 193 GLN n 1 194 GLY n 1 195 ASP n 1 196 SER n 1 197 GLY n 1 198 GLY n 1 199 PRO n 1 200 VAL n 1 201 VAL n 1 202 CYS n 1 203 ASN n 1 204 GLY n 1 205 GLU n 1 206 LEU n 1 207 GLN n 1 208 GLY n 1 209 VAL n 1 210 VAL n 1 211 SER n 1 212 TRP n 1 213 GLY n 1 214 TYR n 1 215 GLY n 1 216 CYS n 1 217 ALA n 1 218 GLU n 1 219 PRO n 1 220 GLY n 1 221 ASN n 1 222 PRO n 1 223 GLY n 1 224 VAL n 1 225 TYR n 1 226 ALA n 1 227 LYS n 1 228 VAL n 1 229 CYS n 1 230 ILE n 1 231 PHE n 1 232 ASN n 1 233 ASP n 1 234 TRP n 1 235 LEU n 1 236 THR n 1 237 SER n 1 238 THR n 1 239 MET n 1 240 ALA n 1 241 SER n 1 242 TYR n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'ATLANTIC SALMON' _entity_src_nat.pdbx_organism_scientific 'SALMO SALAR' _entity_src_nat.pdbx_ncbi_taxonomy_id 8030 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ 'PYLORIC CAECA' _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY1_SALSA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P35031 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UTM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 242 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35031 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 242 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -5 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1UTM PRO A 29 ? UNP P35031 ALA 29 conflict 24 1 1 1UTM PRO A 33 ? UNP P35031 THR 33 conflict 28 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEA non-polymer . 2-PHENYLETHYLAMINE ? 'C8 H12 N 1' 122.188 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1UTM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_percent_sol 37.67 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6.00' # _diffrn.id 1 _diffrn.ambient_temp 295.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.070 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE X31' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline X31 _diffrn_source.pdbx_wavelength 1.070 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1UTM _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 8.000 _reflns.d_resolution_high 1.500 _reflns.number_obs 32883 _reflns.number_all ? _reflns.percent_possible_obs 97.9 _reflns.pdbx_Rmerge_I_obs 0.04800 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 10.1000 _reflns.B_iso_Wilson_estimate 14.25 _reflns.pdbx_redundancy 3.390 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all 93.4 _reflns_shell.Rmerge_I_obs 0.27100 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.800 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1UTM _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 32682 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8 _refine.ls_d_res_high 1.5 _refine.ls_percent_reflns_obs 97.9 _refine.ls_R_factor_obs 0.189 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.189 _refine.ls_R_factor_R_free 0.217 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.0 _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 15.68 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 1UTM _refine_analyze.Luzzati_coordinate_error_obs 0.17 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1666 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 109 _refine_hist.number_atoms_total 1785 _refine_hist.d_res_high 1.5 _refine_hist.d_res_low 8 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.756 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1UTM _struct.title 'Trypsin specificity as elucidated by LIE calculations, X-ray structures and association constant measurements' _struct.pdbx_descriptor 'TRYPSIN I (E.C.3.4.21.4)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UTM _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE, TRYPSIN, INHIBITOR SPECIFICITY, ELECTROSTATIC INTERACTIONS, COLD-ADAPTATION, MOLECULAR DYNAMICS, BINDING FREE ENERGY' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 58 ? TYR A 62 ? ALA A 55 TYR A 59 5 ? 5 HELX_P HELX_P2 2 SER A 163 ? TYR A 171 ? SER A 164 TYR A 172 1 ? 9 HELX_P HELX_P3 3 PHE A 231 ? ALA A 240 ? PHE A 234 ALA A 243 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 156 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.037 ? disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 61 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.039 ? disulf3 disulf ? ? A CYS 129 SG ? ? ? 1_555 A CYS 229 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.042 ? disulf4 disulf ? ? A CYS 136 SG ? ? ? 1_555 A CYS 202 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.036 ? disulf5 disulf ? ? A CYS 167 SG ? ? ? 1_555 A CYS 181 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.030 ? disulf6 disulf ? ? A CYS 192 SG ? ? ? 1_555 A CYS 216 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.045 ? metalc1 metalc ? ? C CA . CA ? ? ? 1_555 A VAL 77 O ? ? A CA 247 A VAL 75 1_555 ? ? ? ? ? ? ? 2.234 ? metalc2 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 82 OE2 ? ? A CA 247 A GLU 80 1_555 ? ? ? ? ? ? ? 2.448 ? metalc3 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 247 A HOH 2020 1_555 ? ? ? ? ? ? ? 2.473 ? metalc4 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 72 OE1 ? ? A CA 247 A GLU 70 1_555 ? ? ? ? ? ? ? 2.394 ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 A ASN 74 O ? ? A CA 247 A ASN 72 1_555 ? ? ? ? ? ? ? 2.380 ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 79 OE1 ? ? A CA 247 A GLU 77 1_555 ? ? ? ? ? ? ? 2.605 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 7 ? AB ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AB 5 6 ? anti-parallel AB 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 TYR A 25 ? GLU A 26 ? TYR A 20 GLU A 21 AA 2 GLN A 155 ? PRO A 160 ? GLN A 156 PRO A 161 AA 3 MET A 135 ? GLY A 140 ? MET A 135 GLY A 140 AA 4 PRO A 199 ? CYS A 202 ? PRO A 198 CYS A 201 AA 5 GLU A 205 ? TRP A 212 ? GLU A 204 TRP A 215 AA 6 GLY A 223 ? LYS A 227 ? GLY A 226 LYS A 230 AA 7 MET A 179 ? ALA A 182 ? MET A 180 ALA A 183 AB 1 GLN A 35 ? ASN A 39 ? GLN A 30 ASN A 34 AB 2 HIS A 43 ? ASN A 51 ? HIS A 40 ASN A 48 AB 3 TRP A 54 ? SER A 57 ? TRP A 51 SER A 54 AB 4 MET A 106 ? LEU A 110 ? MET A 104 LEU A 108 AB 5 GLN A 83 ? ARG A 92 ? GLN A 81 ARG A 90 AB 6 GLU A 67 ? LEU A 70 ? GLU A 64 LEU A 67 AB 7 GLN A 35 ? ASN A 39 ? GLN A 30 ASN A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N TYR A 25 ? N TYR A 20 O CYS A 156 ? O CYS A 157 AA 2 3 N ILE A 159 ? N ILE A 160 O CYS A 136 ? O CYS A 136 AA 3 4 N SER A 139 ? N SER A 139 O PRO A 199 ? O PRO A 198 AA 4 5 N CYS A 202 ? N CYS A 201 O GLU A 205 ? O GLU A 204 AA 5 6 N TRP A 212 ? N TRP A 215 O VAL A 224 ? O VAL A 227 AA 6 7 N TYR A 225 ? N TYR A 228 O PHE A 180 ? O PHE A 181 AB 1 2 O LEU A 38 ? O LEU A 33 N PHE A 44 ? N PHE A 41 AB 2 3 N VAL A 50 ? N VAL A 47 O TRP A 54 ? O TRP A 51 AB 3 4 N SER A 57 ? N SER A 54 O MET A 106 ? O MET A 104 AB 4 5 O LYS A 109 ? O LYS A 107 N SER A 88 ? N SER A 86 AB 5 6 N ILE A 85 ? N ILE A 83 O VAL A 68 ? O VAL A 65 AB 6 7 N ARG A 69 ? N ARG A 66 O SER A 37 ? O SER A 32 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 247' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PEA A 246' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 72 ? GLU A 70 . ? 1_555 ? 2 AC1 6 ASN A 74 ? ASN A 72 . ? 1_555 ? 3 AC1 6 VAL A 77 ? VAL A 75 . ? 1_555 ? 4 AC1 6 GLU A 79 ? GLU A 77 . ? 1_555 ? 5 AC1 6 GLU A 82 ? GLU A 80 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 2020 . ? 1_555 ? 7 AC2 7 ASP A 190 ? ASP A 189 . ? 1_555 ? 8 AC2 7 SER A 191 ? SER A 190 . ? 1_555 ? 9 AC2 7 SER A 196 ? SER A 195 . ? 1_555 ? 10 AC2 7 SER A 211 ? SER A 214 . ? 1_555 ? 11 AC2 7 GLY A 223 ? GLY A 226 . ? 1_555 ? 12 AC2 7 HOH D . ? HOH A 2108 . ? 1_555 ? 13 AC2 7 HOH D . ? HOH A 2109 . ? 1_555 ? # _database_PDB_matrix.entry_id 1UTM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UTM _atom_sites.fract_transf_matrix[1][1] 0.013344 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011753 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031070 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 ILE 2 -4 ? ? ? A . n A 1 3 SER 3 -3 ? ? ? A . n A 1 4 LEU 4 -2 ? ? ? A . n A 1 5 VAL 5 -1 ? ? ? A . n A 1 6 PHE 6 1 ? ? ? A . n A 1 7 VAL 7 2 ? ? ? A . n A 1 8 LEU 8 3 ? ? ? A . n A 1 9 LEU 9 4 ? ? ? A . n A 1 10 ILE 10 5 ? ? ? A . n A 1 11 GLY 11 6 ? ? ? A . n A 1 12 ALA 12 7 ? ? ? A . n A 1 13 ALA 13 8 ? ? ? A . n A 1 14 PHE 14 9 ? ? ? A . n A 1 15 ALA 15 10 ? ? ? A . n A 1 16 THR 16 11 ? ? ? A . n A 1 17 GLU 17 12 ? ? ? A . n A 1 18 ASP 18 13 ? ? ? A . n A 1 19 ASP 19 14 ? ? ? A . n A 1 20 LYS 20 15 ? ? ? A . n A 1 21 ILE 21 16 16 ILE ILE A . n A 1 22 VAL 22 17 17 VAL VAL A . n A 1 23 GLY 23 18 18 GLY GLY A . n A 1 24 GLY 24 19 19 GLY GLY A . n A 1 25 TYR 25 20 20 TYR TYR A . n A 1 26 GLU 26 21 21 GLU GLU A . n A 1 27 CYS 27 22 22 CYS CYS A . n A 1 28 LYS 28 23 23 LYS LYS A . n A 1 29 PRO 29 24 24 PRO PRO A . n A 1 30 TYR 30 25 25 TYR TYR A . n A 1 31 SER 31 26 26 SER SER A . n A 1 32 GLN 32 27 27 GLN GLN A . n A 1 33 PRO 33 28 28 PRO PRO A . n A 1 34 HIS 34 29 29 HIS HIS A . n A 1 35 GLN 35 30 30 GLN GLN A . n A 1 36 VAL 36 31 31 VAL VAL A . n A 1 37 SER 37 32 32 SER SER A . n A 1 38 LEU 38 33 33 LEU LEU A . n A 1 39 ASN 39 34 34 ASN ASN A . n A 1 40 SER 40 37 37 SER SER A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 TYR 42 39 39 TYR TYR A . n A 1 43 HIS 43 40 40 HIS HIS A . n A 1 44 PHE 44 41 41 PHE PHE A . n A 1 45 CYS 45 42 42 CYS CYS A . n A 1 46 GLY 46 43 43 GLY GLY A . n A 1 47 GLY 47 44 44 GLY GLY A . n A 1 48 SER 48 45 45 SER SER A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 VAL 50 47 47 VAL VAL A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 ASN 53 50 50 ASN ASN A . n A 1 54 TRP 54 51 51 TRP TRP A . n A 1 55 VAL 55 52 52 VAL VAL A . n A 1 56 VAL 56 53 53 VAL VAL A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 ALA 58 55 55 ALA ALA A . n A 1 59 ALA 59 56 56 ALA ALA A . n A 1 60 HIS 60 57 57 HIS HIS A . n A 1 61 CYS 61 58 58 CYS CYS A . n A 1 62 TYR 62 59 59 TYR TYR A . n A 1 63 LYS 63 60 60 LYS LYS A . n A 1 64 SER 64 61 61 SER SER A . n A 1 65 ARG 65 62 62 ARG ARG A . n A 1 66 VAL 66 63 63 VAL VAL A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 ARG 69 66 66 ARG ARG A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 GLY 71 69 69 GLY GLY A . n A 1 72 GLU 72 70 70 GLU GLU A . n A 1 73 HIS 73 71 71 HIS HIS A . n A 1 74 ASN 74 72 72 ASN ASN A . n A 1 75 ILE 75 73 73 ILE ILE A . n A 1 76 LYS 76 74 74 LYS LYS A . n A 1 77 VAL 77 75 75 VAL VAL A . n A 1 78 THR 78 76 76 THR THR A . n A 1 79 GLU 79 77 77 GLU GLU A . n A 1 80 GLY 80 78 78 GLY GLY A . n A 1 81 SER 81 79 79 SER SER A . n A 1 82 GLU 82 80 80 GLU GLU A . n A 1 83 GLN 83 81 81 GLN GLN A . n A 1 84 PHE 84 82 82 PHE PHE A . n A 1 85 ILE 85 83 83 ILE ILE A . n A 1 86 SER 86 84 84 SER SER A . n A 1 87 SER 87 85 85 SER SER A . n A 1 88 SER 88 86 86 SER SER A . n A 1 89 ARG 89 87 87 ARG ARG A . n A 1 90 VAL 90 88 88 VAL VAL A . n A 1 91 ILE 91 89 89 ILE ILE A . n A 1 92 ARG 92 90 90 ARG ARG A . n A 1 93 HIS 93 91 91 HIS HIS A . n A 1 94 PRO 94 92 92 PRO PRO A . n A 1 95 ASN 95 93 93 ASN ASN A . n A 1 96 TYR 96 94 94 TYR TYR A . n A 1 97 SER 97 95 95 SER SER A . n A 1 98 SER 98 96 96 SER SER A . n A 1 99 TYR 99 97 97 TYR TYR A . n A 1 100 ASN 100 98 98 ASN ASN A . n A 1 101 ILE 101 99 99 ILE ILE A . n A 1 102 ASP 102 100 100 ASP ASP A . n A 1 103 ASN 103 101 101 ASN ASN A . n A 1 104 ASP 104 102 102 ASP ASP A . n A 1 105 ILE 105 103 103 ILE ILE A . n A 1 106 MET 106 104 104 MET MET A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 ILE 108 106 106 ILE ILE A . n A 1 109 LYS 109 107 107 LYS LYS A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 SER 111 109 109 SER SER A . n A 1 112 LYS 112 110 110 LYS LYS A . n A 1 113 PRO 113 111 111 PRO PRO A . n A 1 114 ALA 114 112 112 ALA ALA A . n A 1 115 THR 115 113 113 THR THR A . n A 1 116 LEU 116 114 114 LEU LEU A . n A 1 117 ASN 117 115 115 ASN ASN A . n A 1 118 THR 118 116 116 THR THR A . n A 1 119 TYR 119 117 117 TYR TYR A . n A 1 120 VAL 120 118 118 VAL VAL A . n A 1 121 GLN 121 119 119 GLN GLN A . n A 1 122 PRO 122 120 120 PRO PRO A . n A 1 123 VAL 123 121 121 VAL VAL A . n A 1 124 ALA 124 122 122 ALA ALA A . n A 1 125 LEU 125 123 123 LEU LEU A . n A 1 126 PRO 126 124 124 PRO PRO A . n A 1 127 THR 127 125 125 THR THR A . n A 1 128 SER 128 127 127 SER SER A . n A 1 129 CYS 129 128 128 CYS CYS A . n A 1 130 ALA 130 129 129 ALA ALA A . n A 1 131 PRO 131 130 130 PRO PRO A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 SER 151 152 152 SER SER A . n A 1 152 ASN 152 153 153 ASN ASN A . n A 1 153 LYS 153 154 154 LYS LYS A . n A 1 154 LEU 154 155 155 LEU LEU A . n A 1 155 GLN 155 156 156 GLN GLN A . n A 1 156 CYS 156 157 157 CYS CYS A . n A 1 157 LEU 157 158 158 LEU LEU A . n A 1 158 ASN 158 159 159 ASN ASN A . n A 1 159 ILE 159 160 160 ILE ILE A . n A 1 160 PRO 160 161 161 PRO PRO A . n A 1 161 ILE 161 162 162 ILE ILE A . n A 1 162 LEU 162 163 163 LEU LEU A . n A 1 163 SER 163 164 164 SER SER A . n A 1 164 TYR 164 165 165 TYR TYR A . n A 1 165 SER 165 166 166 SER SER A . n A 1 166 ASP 166 167 167 ASP ASP A . n A 1 167 CYS 167 168 168 CYS CYS A . n A 1 168 ASN 168 169 169 ASN ASN A . n A 1 169 ASN 169 170 170 ASN ASN A . n A 1 170 SER 170 171 171 SER SER A . n A 1 171 TYR 171 172 172 TYR TYR A . n A 1 172 PRO 172 173 173 PRO PRO A . n A 1 173 GLY 173 174 174 GLY GLY A . n A 1 174 MET 174 175 175 MET MET A . n A 1 175 ILE 175 176 176 ILE ILE A . n A 1 176 THR 176 177 177 THR THR A . n A 1 177 ASN 177 178 178 ASN ASN A . n A 1 178 ALA 178 179 179 ALA ALA A . n A 1 179 MET 179 180 180 MET MET A . n A 1 180 PHE 180 181 181 PHE PHE A . n A 1 181 CYS 181 182 182 CYS CYS A . n A 1 182 ALA 182 183 183 ALA ALA A . n A 1 183 GLY 183 184 184 GLY GLY A . n A 1 184 TYR 184 184 184 TYR TYR A A n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 LYS 189 188 188 LYS LYS A A n A 1 190 ASP 190 189 189 ASP ASP A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 CYS 192 191 191 CYS CYS A . n A 1 193 GLN 193 192 192 GLN GLN A . n A 1 194 GLY 194 193 193 GLY GLY A . n A 1 195 ASP 195 194 194 ASP ASP A . n A 1 196 SER 196 195 195 SER SER A . n A 1 197 GLY 197 196 196 GLY GLY A . n A 1 198 GLY 198 197 197 GLY GLY A . n A 1 199 PRO 199 198 198 PRO PRO A . n A 1 200 VAL 200 199 199 VAL VAL A . n A 1 201 VAL 201 200 200 VAL VAL A . n A 1 202 CYS 202 201 201 CYS CYS A . n A 1 203 ASN 203 202 202 ASN ASN A . n A 1 204 GLY 204 203 203 GLY GLY A . n A 1 205 GLU 205 204 204 GLU GLU A . n A 1 206 LEU 206 209 209 LEU LEU A . n A 1 207 GLN 207 210 210 GLN GLN A . n A 1 208 GLY 208 211 211 GLY GLY A . n A 1 209 VAL 209 212 212 VAL VAL A . n A 1 210 VAL 210 213 213 VAL VAL A . n A 1 211 SER 211 214 214 SER SER A . n A 1 212 TRP 212 215 215 TRP TRP A . n A 1 213 GLY 213 216 216 GLY GLY A . n A 1 214 TYR 214 217 217 TYR TYR A . n A 1 215 GLY 215 219 219 GLY GLY A . n A 1 216 CYS 216 220 220 CYS CYS A . n A 1 217 ALA 217 221 221 ALA ALA A . n A 1 218 GLU 218 221 221 GLU GLU A A n A 1 219 PRO 219 222 222 PRO PRO A . n A 1 220 GLY 220 223 223 GLY GLY A . n A 1 221 ASN 221 224 224 ASN ASN A . n A 1 222 PRO 222 225 225 PRO PRO A . n A 1 223 GLY 223 226 226 GLY GLY A . n A 1 224 VAL 224 227 227 VAL VAL A . n A 1 225 TYR 225 228 228 TYR TYR A . n A 1 226 ALA 226 229 229 ALA ALA A . n A 1 227 LYS 227 230 230 LYS LYS A . n A 1 228 VAL 228 231 231 VAL VAL A . n A 1 229 CYS 229 232 232 CYS CYS A . n A 1 230 ILE 230 233 233 ILE ILE A . n A 1 231 PHE 231 234 234 PHE PHE A . n A 1 232 ASN 232 235 235 ASN ASN A . n A 1 233 ASP 233 236 236 ASP ASP A . n A 1 234 TRP 234 237 237 TRP TRP A . n A 1 235 LEU 235 238 238 LEU LEU A . n A 1 236 THR 236 239 239 THR THR A . n A 1 237 SER 237 240 240 SER SER A . n A 1 238 THR 238 241 241 THR THR A . n A 1 239 MET 239 242 242 MET MET A . n A 1 240 ALA 240 243 243 ALA ALA A . n A 1 241 SER 241 244 244 SER SER A . n A 1 242 TYR 242 245 245 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEA 1 246 246 PEA PEA A . C 3 CA 1 247 247 CA CA A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A VAL 77 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE2 ? A GLU 82 ? A GLU 80 ? 1_555 88.7 ? 2 O ? A VAL 77 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 O ? D HOH . ? A HOH 2020 ? 1_555 86.3 ? 3 OE2 ? A GLU 82 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 O ? D HOH . ? A HOH 2020 ? 1_555 85.8 ? 4 O ? A VAL 77 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 72 ? A GLU 70 ? 1_555 160.2 ? 5 OE2 ? A GLU 82 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 72 ? A GLU 70 ? 1_555 99.7 ? 6 O ? D HOH . ? A HOH 2020 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 72 ? A GLU 70 ? 1_555 76.5 ? 7 O ? A VAL 77 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 O ? A ASN 74 ? A ASN 72 ? 1_555 86.5 ? 8 OE2 ? A GLU 82 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 O ? A ASN 74 ? A ASN 72 ? 1_555 170.3 ? 9 O ? D HOH . ? A HOH 2020 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 O ? A ASN 74 ? A ASN 72 ? 1_555 102.1 ? 10 OE1 ? A GLU 72 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 O ? A ASN 74 ? A ASN 72 ? 1_555 87.6 ? 11 O ? A VAL 77 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 79 ? A GLU 77 ? 1_555 100.3 ? 12 OE2 ? A GLU 82 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 79 ? A GLU 77 ? 1_555 86.2 ? 13 O ? D HOH . ? A HOH 2020 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 79 ? A GLU 77 ? 1_555 169.5 ? 14 OE1 ? A GLU 72 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 79 ? A GLU 77 ? 1_555 98.1 ? 15 O ? A ASN 74 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 247 ? 1_555 OE1 ? A GLU 79 ? A GLU 77 ? 1_555 86.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-01-09 2 'Structure model' 1 1 2011-06-02 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 3 4 'Structure model' pdbx_unobs_or_zero_occ_residues # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR refinement . ? 1 DENZO 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET DETERMINATION METHOD: DSSP THE SHEETS PRESENTED AS "AB" IN EACH CHAIN ON SHEET RECORDS BELOW IS ACTUALLY AN 6-STRANDED BARREL THIS IS REPRESENTED BY A 7-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS ARE IDENTICAL. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 28 ? ? -59.84 -9.52 2 1 HIS A 71 ? ? -124.91 -61.94 3 1 ASN A 115 ? ? -156.92 -155.12 4 1 SER A 214 ? ? -115.99 -73.28 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A ILE -4 ? A ILE 2 3 1 Y 1 A SER -3 ? A SER 3 4 1 Y 1 A LEU -2 ? A LEU 4 5 1 Y 1 A VAL -1 ? A VAL 5 6 1 Y 1 A PHE 1 ? A PHE 6 7 1 Y 1 A VAL 2 ? A VAL 7 8 1 Y 1 A LEU 3 ? A LEU 8 9 1 Y 1 A LEU 4 ? A LEU 9 10 1 Y 1 A ILE 5 ? A ILE 10 11 1 Y 1 A GLY 6 ? A GLY 11 12 1 Y 1 A ALA 7 ? A ALA 12 13 1 Y 1 A ALA 8 ? A ALA 13 14 1 Y 1 A PHE 9 ? A PHE 14 15 1 Y 1 A ALA 10 ? A ALA 15 16 1 Y 1 A THR 11 ? A THR 16 17 1 Y 1 A GLU 12 ? A GLU 17 18 1 Y 1 A ASP 13 ? A ASP 18 19 1 Y 1 A ASP 14 ? A ASP 19 20 1 Y 1 A LYS 15 ? A LYS 20 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-PHENYLETHYLAMINE PEA 3 'CALCIUM ION' CA 4 water HOH #