data_1UVF # _entry.id 1UVF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UVF PDBE EBI-14413 WWPDB D_1290014413 BMRB 6179 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1H0Z unspecified 'LEKTI DOMAIN SIX (HF7665)' PDB 1HDL unspecified 'LEKTI DOMAIN ONE' PDB 1UUC unspecified 'SOLUTION STRUCTURE OF A CHIMARIC LEKTI-DOMAIN' PDB 1UVG unspecified 'SOLUTION STRUCTURE OF THE 15TH DOMAIN OF LEKTI' BMRB 6179 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UVF _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-01-20 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vitzithum, K.' 1 'Roesch, P.' 2 'Marx, U.C.' 3 # _citation.id primary _citation.title 'The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence' _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 11238 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15366933 _citation.pdbx_database_id_DOI 10.1021/BI0492399 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Tidow, H.' 1 primary 'Lauber, T.' 2 primary 'Vitzithum, K.' 3 primary 'Sommerhoff, C.' 4 primary 'Roesch, P.' 5 primary 'Marx, U.C.' 6 # _cell.entry_id 1UVF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UVF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SERINE PROTEINASE INHIBITOR KAZAL TYPE 5' _entity.formula_weight 6938.950 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SHORT LEKTI-DOMAIN15, RESIDUES 989-1047' _entity.details 'DISULPHIDE BONDS BETWEEN CYS5 AND CYS40, BETWEEN CYS18 AND CYS37 AND BETWEEN CYS26 AND CYS58' # _entity_name_com.entity_id 1 _entity_name_com.name 'LYMPHO-EPITHELIAL, KAZAL-TYPE RELATED INHIBITOR, LEKTI' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPDSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCE _entity_poly.pdbx_seq_one_letter_code_can GPDSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ASP n 1 4 SER n 1 5 GLU n 1 6 MET n 1 7 CYS n 1 8 LYS n 1 9 ASP n 1 10 TYR n 1 11 ARG n 1 12 VAL n 1 13 LEU n 1 14 PRO n 1 15 ARG n 1 16 ILE n 1 17 GLY n 1 18 TYR n 1 19 LEU n 1 20 CYS n 1 21 PRO n 1 22 LYS n 1 23 ASP n 1 24 LEU n 1 25 LYS n 1 26 PRO n 1 27 VAL n 1 28 CYS n 1 29 GLY n 1 30 ASP n 1 31 ASP n 1 32 GLY n 1 33 GLN n 1 34 THR n 1 35 TYR n 1 36 ASN n 1 37 ASN n 1 38 PRO n 1 39 CYS n 1 40 MET n 1 41 LEU n 1 42 CYS n 1 43 HIS n 1 44 GLU n 1 45 ASN n 1 46 LEU n 1 47 ILE n 1 48 ARG n 1 49 GLN n 1 50 THR n 1 51 ASN n 1 52 THR n 1 53 HIS n 1 54 ILE n 1 55 ARG n 1 56 SER n 1 57 THR n 1 58 GLY n 1 59 LYS n 1 60 CYS n 1 61 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue 'VAGINAL EPITHELIUM' _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ORIGAMI _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector T7-EXPRESSIONSVECTOR _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET32-A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1UVF 1 ? ? 1UVF ? 2 UNP ISK5_HUMAN 1 ? ? Q9NQ38 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1UVF A 1 ? 2 ? 1UVF -2 ? -1 ? -2 -1 2 2 1UVF A 3 ? 61 ? Q9NQ38 989 ? 1047 ? 1 59 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 2D-TOCSY 1 2 1 2D-COSY 1 3 1 2D-NOESY 1 4 1 1H 1 5 1 15N-HSQC 1 6 1 HNHA 1 7 1 3D-1H 1 8 1 1H 1 9 1 15N-TOCSY-HSQC 1 10 1 3D-1H 1 11 1 1H 1 12 1 15N-NOESY-HSQC 1 13 1 3D-1H 1 14 1 15N 1 15 1 15N-HMQC-NOESY-HSQC 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% H20/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1UVF _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'SIMULATED ANNEALING' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1UVF _pdbx_nmr_details.text 'THIS STRUCTURE WAS DETERMINED USING STANDARD NMR-TECHNIQUES ON 15N-LABELED AND UNLABELED PROTEIN' # _pdbx_nmr_ensemble.entry_id 1UVF _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 31 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY; LEAST RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 1UVF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.8.51 BRUNGER 1 'structure solution' NDEE ? ? 2 'structure solution' NMRVIEW 5.0.4 ? 3 # _exptl.entry_id 1UVF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1UVF _struct.title 'Solution Structure of the structured part of the 15th Domain of LEKTI' _struct.pdbx_descriptor 'SERINE PROTEINASE INHIBITOR KAZAL TYPE 5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UVF _struct_keywords.pdbx_keywords 'SERINE PROTEINASE INHIBITOR' _struct_keywords.text 'SERINE PROTEINASE INHIBITOR, TRYPSIN INHIBITOR, KAZAL, PROTEASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 3 ? LYS A 8 ? ASP A 1 LYS A 6 1 ? 6 HELX_P HELX_P2 2 PRO A 38 ? GLN A 49 ? PRO A 36 GLN A 47 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 5 A CYS 40 1_555 ? ? ? ? ? ? ? 2.014 ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 18 A CYS 37 1_555 ? ? ? ? ? ? ? 2.018 ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 26 A CYS 58 1_555 ? ? ? ? ? ? ? 2.019 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 33 ? TYR A 35 ? GLN A 31 TYR A 33 AA 2 VAL A 27 ? GLY A 29 ? VAL A 25 GLY A 27 AA 3 ILE A 54 ? THR A 57 ? ILE A 52 THR A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N TYR A 35 ? N TYR A 33 O VAL A 27 ? O VAL A 25 AA 2 3 O CYS A 28 ? O CYS A 26 N ARG A 55 ? N ARG A 53 # _database_PDB_matrix.entry_id 1UVF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UVF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 PRO 2 -1 ? ? ? A . n A 1 3 ASP 3 1 1 ASP ASP A . n A 1 4 SER 4 2 2 SER SER A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 MET 6 4 4 MET MET A . n A 1 7 CYS 7 5 5 CYS CYS A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 ASP 9 7 7 ASP ASP A . n A 1 10 TYR 10 8 8 TYR TYR A . n A 1 11 ARG 11 9 9 ARG ARG A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 LEU 13 11 11 LEU LEU A . n A 1 14 PRO 14 12 12 PRO PRO A . n A 1 15 ARG 15 13 13 ARG ARG A . n A 1 16 ILE 16 14 14 ILE ILE A . n A 1 17 GLY 17 15 15 GLY GLY A . n A 1 18 TYR 18 16 16 TYR TYR A . n A 1 19 LEU 19 17 17 LEU LEU A . n A 1 20 CYS 20 18 18 CYS CYS A . n A 1 21 PRO 21 19 19 PRO PRO A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 LEU 24 22 22 LEU LEU A . n A 1 25 LYS 25 23 23 LYS LYS A . n A 1 26 PRO 26 24 24 PRO PRO A . n A 1 27 VAL 27 25 25 VAL VAL A . n A 1 28 CYS 28 26 26 CYS CYS A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 ASP 30 28 28 ASP ASP A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 GLY 32 30 30 GLY GLY A . n A 1 33 GLN 33 31 31 GLN GLN A . n A 1 34 THR 34 32 32 THR THR A . n A 1 35 TYR 35 33 33 TYR TYR A . n A 1 36 ASN 36 34 34 ASN ASN A . n A 1 37 ASN 37 35 35 ASN ASN A . n A 1 38 PRO 38 36 36 PRO PRO A . n A 1 39 CYS 39 37 37 CYS CYS A . n A 1 40 MET 40 38 38 MET MET A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 CYS 42 40 40 CYS CYS A . n A 1 43 HIS 43 41 41 HIS HIS A . n A 1 44 GLU 44 42 42 GLU GLU A . n A 1 45 ASN 45 43 43 ASN ASN A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 ILE 47 45 45 ILE ILE A . n A 1 48 ARG 48 46 46 ARG ARG A . n A 1 49 GLN 49 47 47 GLN GLN A . n A 1 50 THR 50 48 48 THR THR A . n A 1 51 ASN 51 49 49 ASN ASN A . n A 1 52 THR 52 50 50 THR THR A . n A 1 53 HIS 53 51 51 HIS HIS A . n A 1 54 ILE 54 52 52 ILE ILE A . n A 1 55 ARG 55 53 53 ARG ARG A . n A 1 56 SER 56 54 54 SER SER A . n A 1 57 THR 57 55 55 THR THR A . n A 1 58 GLY 58 56 56 GLY GLY A . n A 1 59 LYS 59 57 57 LYS LYS A . n A 1 60 CYS 60 58 58 CYS CYS A . n A 1 61 GLU 61 59 59 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-04-14 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_entry_details.entry_id 1UVF _pdbx_entry_details.compound_details ;FUNCTION: SERINE PROTEASE INHIBITOR, PROBABLY IMPORTANT FOR THE ANTI-INFLAMMATORY AND/OR ANTIMICROBIAL PROTECTION OF MUCOUS EPITHELIA. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 2 1 O A CYS 26 ? ? H A ARG 53 ? ? 1.58 3 2 O A CYS 26 ? ? H A ARG 53 ? ? 1.51 4 2 O A CYS 5 ? ? H A TYR 8 ? ? 1.56 5 2 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 6 2 O A ASN 43 ? ? H A GLN 47 ? ? 1.59 7 3 O A CYS 26 ? ? H A ARG 53 ? ? 1.53 8 4 O A CYS 26 ? ? H A ARG 53 ? ? 1.53 9 4 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 10 5 O A CYS 26 ? ? H A ARG 53 ? ? 1.50 11 6 O A CYS 26 ? ? H A ARG 53 ? ? 1.55 12 6 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 13 6 O A ASN 43 ? ? H A GLN 47 ? ? 1.58 14 7 O A CYS 26 ? ? H A ARG 53 ? ? 1.51 15 7 O A ASN 43 ? ? H A GLN 47 ? ? 1.56 16 7 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 17 8 O A CYS 26 ? ? H A ARG 53 ? ? 1.50 18 8 OD2 A ASP 28 ? ? HD1 A HIS 51 ? ? 1.55 19 8 H A GLY 27 ? ? O A GLN 31 ? ? 1.55 20 9 O A ASP 1 ? ? H A MET 4 ? ? 1.55 21 9 O A CYS 5 ? ? H A TYR 8 ? ? 1.56 22 9 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 23 9 O A CYS 26 ? ? H A ARG 53 ? ? 1.57 24 9 O A ASN 43 ? ? H A GLN 47 ? ? 1.58 25 10 O A CYS 26 ? ? H A ARG 53 ? ? 1.51 26 10 H A GLY 27 ? ? O A GLN 31 ? ? 1.60 27 11 O A CYS 26 ? ? H A ARG 53 ? ? 1.51 28 11 O A ASP 1 ? ? H A MET 4 ? ? 1.59 29 12 O A CYS 26 ? ? H A ARG 53 ? ? 1.54 30 12 OH A TYR 8 ? ? H A LEU 17 ? ? 1.58 31 13 O A CYS 26 ? ? H A ARG 53 ? ? 1.54 32 14 O A CYS 26 ? ? H A ARG 53 ? ? 1.53 33 15 O A CYS 26 ? ? H A ARG 53 ? ? 1.50 34 15 O A CYS 5 ? ? H A TYR 8 ? ? 1.58 35 16 O A CYS 26 ? ? H A ARG 53 ? ? 1.56 36 16 O A ASN 43 ? ? H A GLN 47 ? ? 1.56 37 17 O A CYS 26 ? ? H A ARG 53 ? ? 1.55 38 17 H A GLY 27 ? ? O A GLN 31 ? ? 1.57 39 18 O A CYS 26 ? ? H A ARG 53 ? ? 1.50 40 18 O A ASP 1 ? ? H A MET 4 ? ? 1.59 41 18 O A ASN 43 ? ? H A GLN 47 ? ? 1.59 42 19 O A CYS 26 ? ? H A ARG 53 ? ? 1.51 43 19 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 44 19 O A CYS 5 ? ? H A TYR 8 ? ? 1.59 45 19 OD2 A ASP 29 ? ? HG1 A THR 50 ? ? 1.59 46 20 O A CYS 26 ? ? H A ARG 53 ? ? 1.51 47 20 O A ASN 43 ? ? H A GLN 47 ? ? 1.55 48 20 H A GLY 27 ? ? O A GLN 31 ? ? 1.57 49 21 O A CYS 26 ? ? H A ARG 53 ? ? 1.52 50 21 O A ASN 43 ? ? H A GLN 47 ? ? 1.56 51 22 O A CYS 26 ? ? H A ARG 53 ? ? 1.49 52 22 H A GLY 27 ? ? O A GLN 31 ? ? 1.59 53 23 O A CYS 26 ? ? H A ARG 53 ? ? 1.50 54 24 O A CYS 26 ? ? H A ARG 53 ? ? 1.53 55 24 O A ASN 43 ? ? H A GLN 47 ? ? 1.58 56 24 H A GLY 27 ? ? O A GLN 31 ? ? 1.58 57 25 O A CYS 26 ? ? H A ARG 53 ? ? 1.52 58 25 O A CYS 40 ? ? H A ASN 43 ? ? 1.59 59 26 O A CYS 26 ? ? H A ARG 53 ? ? 1.50 60 26 H A GLY 27 ? ? O A GLN 31 ? ? 1.56 61 27 O A CYS 26 ? ? H A ARG 53 ? ? 1.55 62 27 H A GLY 27 ? ? O A GLN 31 ? ? 1.57 63 27 HG A SER 2 ? ? O A THR 50 ? ? 1.58 64 27 HH22 A ARG 46 ? ? OG1 A THR 50 ? ? 1.59 65 28 O A CYS 26 ? ? H A ARG 53 ? ? 1.53 66 28 H A GLY 27 ? ? O A GLN 31 ? ? 1.55 67 29 O A CYS 26 ? ? H A ARG 53 ? ? 1.53 68 29 H A GLY 27 ? ? O A GLN 31 ? ? 1.55 69 30 O A CYS 26 ? ? H A ARG 53 ? ? 1.49 70 30 H A GLY 27 ? ? O A GLN 31 ? ? 1.57 71 31 O A CYS 26 ? ? H A ARG 53 ? ? 1.49 72 31 H A GLY 27 ? ? O A GLN 31 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 34 ? ? -46.71 -78.22 2 2 TYR A 16 ? ? -43.85 153.58 3 2 ASN A 34 ? ? -49.79 -77.84 4 3 ASN A 34 ? ? -53.07 -75.98 5 4 ASN A 34 ? ? -41.74 -77.35 6 4 ASN A 49 ? ? -112.03 51.81 7 5 ASN A 34 ? ? -48.66 -79.44 8 5 ASN A 49 ? ? -103.16 56.52 9 6 ASN A 34 ? ? -44.61 -82.40 10 6 ASN A 49 ? ? -101.57 64.45 11 7 ASP A 7 ? ? -150.69 63.51 12 7 ASN A 34 ? ? -52.77 -78.43 13 8 ASN A 34 ? ? -50.96 -78.48 14 9 ASN A 34 ? ? -48.18 -79.26 15 10 ASN A 34 ? ? -53.57 -76.40 16 11 ASN A 34 ? ? -50.44 -78.47 17 11 ASN A 49 ? ? -95.68 59.99 18 12 ASN A 34 ? ? -51.14 -79.27 19 12 ASN A 49 ? ? -103.37 65.21 20 13 ASN A 34 ? ? -49.36 -77.63 21 13 ASN A 49 ? ? -103.98 56.73 22 14 ASP A 7 ? ? -145.02 19.33 23 14 ASN A 34 ? ? -46.89 -82.07 24 15 ASN A 34 ? ? -41.97 -80.61 25 16 TYR A 16 ? ? -41.88 152.00 26 16 ASN A 34 ? ? -45.99 -80.19 27 17 ASN A 34 ? ? -54.68 -78.56 28 17 ASN A 49 ? ? -96.77 57.37 29 18 ASN A 34 ? ? -51.55 -79.28 30 19 ASN A 34 ? ? -54.52 -78.15 31 20 ASN A 34 ? ? -50.60 -80.19 32 21 ASN A 34 ? ? -49.41 -81.46 33 22 ASN A 34 ? ? -53.77 -78.51 34 22 ASN A 49 ? ? -103.56 63.29 35 23 ASP A 7 ? ? -148.93 57.55 36 23 ASN A 34 ? ? -61.03 -76.02 37 23 ASN A 49 ? ? -94.30 57.83 38 23 HIS A 51 ? ? -115.79 -169.22 39 24 ASP A 7 ? ? -151.31 64.51 40 24 ASN A 34 ? ? -67.98 -75.53 41 25 TYR A 16 ? ? -42.27 152.61 42 25 ASN A 34 ? ? -58.54 -75.23 43 25 ASN A 49 ? ? -94.75 58.87 44 26 ASN A 34 ? ? -45.55 -78.88 45 26 LYS A 57 ? ? -49.59 159.40 46 27 ASN A 34 ? ? -52.66 -78.97 47 28 ASP A 7 ? ? -151.56 65.77 48 28 ASN A 34 ? ? -43.60 -78.17 49 28 ASN A 49 ? ? -107.59 64.78 50 29 ASN A 34 ? ? -53.80 -76.07 51 29 ASN A 49 ? ? -100.13 61.37 52 30 ASN A 34 ? ? -43.09 -75.49 53 31 ASN A 34 ? ? -55.41 -76.95 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 9 ? ? 0.235 'SIDE CHAIN' 2 1 ARG A 13 ? ? 0.252 'SIDE CHAIN' 3 1 ARG A 46 ? ? 0.106 'SIDE CHAIN' 4 1 ARG A 53 ? ? 0.233 'SIDE CHAIN' 5 2 ARG A 9 ? ? 0.298 'SIDE CHAIN' 6 2 ARG A 13 ? ? 0.317 'SIDE CHAIN' 7 2 ARG A 46 ? ? 0.219 'SIDE CHAIN' 8 2 ARG A 53 ? ? 0.315 'SIDE CHAIN' 9 3 ARG A 9 ? ? 0.249 'SIDE CHAIN' 10 3 ARG A 13 ? ? 0.282 'SIDE CHAIN' 11 3 ARG A 46 ? ? 0.314 'SIDE CHAIN' 12 3 ARG A 53 ? ? 0.301 'SIDE CHAIN' 13 4 ARG A 9 ? ? 0.207 'SIDE CHAIN' 14 4 ARG A 13 ? ? 0.260 'SIDE CHAIN' 15 4 ARG A 46 ? ? 0.310 'SIDE CHAIN' 16 4 ARG A 53 ? ? 0.147 'SIDE CHAIN' 17 5 ARG A 9 ? ? 0.242 'SIDE CHAIN' 18 5 ARG A 13 ? ? 0.258 'SIDE CHAIN' 19 5 ARG A 46 ? ? 0.282 'SIDE CHAIN' 20 5 ARG A 53 ? ? 0.318 'SIDE CHAIN' 21 6 ARG A 9 ? ? 0.241 'SIDE CHAIN' 22 6 ARG A 13 ? ? 0.272 'SIDE CHAIN' 23 6 ARG A 46 ? ? 0.306 'SIDE CHAIN' 24 6 ARG A 53 ? ? 0.263 'SIDE CHAIN' 25 7 ARG A 9 ? ? 0.267 'SIDE CHAIN' 26 7 ARG A 13 ? ? 0.107 'SIDE CHAIN' 27 7 ARG A 46 ? ? 0.316 'SIDE CHAIN' 28 7 ARG A 53 ? ? 0.194 'SIDE CHAIN' 29 8 ARG A 9 ? ? 0.227 'SIDE CHAIN' 30 8 ARG A 13 ? ? 0.301 'SIDE CHAIN' 31 8 ARG A 46 ? ? 0.159 'SIDE CHAIN' 32 8 ARG A 53 ? ? 0.310 'SIDE CHAIN' 33 9 ARG A 9 ? ? 0.237 'SIDE CHAIN' 34 9 ARG A 13 ? ? 0.315 'SIDE CHAIN' 35 9 ARG A 46 ? ? 0.300 'SIDE CHAIN' 36 9 ARG A 53 ? ? 0.316 'SIDE CHAIN' 37 10 ARG A 9 ? ? 0.317 'SIDE CHAIN' 38 10 ARG A 13 ? ? 0.193 'SIDE CHAIN' 39 10 ARG A 46 ? ? 0.265 'SIDE CHAIN' 40 10 ARG A 53 ? ? 0.318 'SIDE CHAIN' 41 11 ARG A 9 ? ? 0.316 'SIDE CHAIN' 42 11 ARG A 13 ? ? 0.139 'SIDE CHAIN' 43 11 ARG A 46 ? ? 0.216 'SIDE CHAIN' 44 11 ARG A 53 ? ? 0.237 'SIDE CHAIN' 45 12 ARG A 9 ? ? 0.180 'SIDE CHAIN' 46 12 ARG A 13 ? ? 0.298 'SIDE CHAIN' 47 12 ARG A 46 ? ? 0.194 'SIDE CHAIN' 48 13 ARG A 9 ? ? 0.317 'SIDE CHAIN' 49 13 ARG A 13 ? ? 0.216 'SIDE CHAIN' 50 13 ARG A 46 ? ? 0.137 'SIDE CHAIN' 51 13 ARG A 53 ? ? 0.282 'SIDE CHAIN' 52 14 ARG A 9 ? ? 0.316 'SIDE CHAIN' 53 14 ARG A 13 ? ? 0.298 'SIDE CHAIN' 54 14 ARG A 46 ? ? 0.203 'SIDE CHAIN' 55 14 ARG A 53 ? ? 0.213 'SIDE CHAIN' 56 15 ARG A 9 ? ? 0.186 'SIDE CHAIN' 57 15 ARG A 13 ? ? 0.307 'SIDE CHAIN' 58 15 ARG A 46 ? ? 0.272 'SIDE CHAIN' 59 15 ARG A 53 ? ? 0.314 'SIDE CHAIN' 60 16 ARG A 9 ? ? 0.271 'SIDE CHAIN' 61 16 ARG A 13 ? ? 0.273 'SIDE CHAIN' 62 16 ARG A 46 ? ? 0.268 'SIDE CHAIN' 63 16 ARG A 53 ? ? 0.300 'SIDE CHAIN' 64 17 ARG A 9 ? ? 0.306 'SIDE CHAIN' 65 17 ARG A 13 ? ? 0.154 'SIDE CHAIN' 66 17 ARG A 46 ? ? 0.112 'SIDE CHAIN' 67 17 ARG A 53 ? ? 0.189 'SIDE CHAIN' 68 18 ARG A 9 ? ? 0.312 'SIDE CHAIN' 69 18 ARG A 13 ? ? 0.140 'SIDE CHAIN' 70 18 ARG A 46 ? ? 0.258 'SIDE CHAIN' 71 18 ARG A 53 ? ? 0.316 'SIDE CHAIN' 72 19 ARG A 9 ? ? 0.158 'SIDE CHAIN' 73 19 ARG A 13 ? ? 0.305 'SIDE CHAIN' 74 19 ARG A 46 ? ? 0.307 'SIDE CHAIN' 75 19 ARG A 53 ? ? 0.209 'SIDE CHAIN' 76 20 ARG A 9 ? ? 0.317 'SIDE CHAIN' 77 20 ARG A 13 ? ? 0.316 'SIDE CHAIN' 78 20 ARG A 46 ? ? 0.304 'SIDE CHAIN' 79 20 ARG A 53 ? ? 0.114 'SIDE CHAIN' 80 21 ARG A 9 ? ? 0.148 'SIDE CHAIN' 81 21 ARG A 13 ? ? 0.213 'SIDE CHAIN' 82 21 ARG A 46 ? ? 0.198 'SIDE CHAIN' 83 21 ARG A 53 ? ? 0.260 'SIDE CHAIN' 84 22 ARG A 9 ? ? 0.274 'SIDE CHAIN' 85 22 ARG A 13 ? ? 0.237 'SIDE CHAIN' 86 22 ARG A 46 ? ? 0.317 'SIDE CHAIN' 87 22 ARG A 53 ? ? 0.286 'SIDE CHAIN' 88 23 ARG A 9 ? ? 0.318 'SIDE CHAIN' 89 23 ARG A 13 ? ? 0.279 'SIDE CHAIN' 90 23 ARG A 46 ? ? 0.267 'SIDE CHAIN' 91 23 ARG A 53 ? ? 0.214 'SIDE CHAIN' 92 24 ARG A 9 ? ? 0.278 'SIDE CHAIN' 93 24 ARG A 13 ? ? 0.209 'SIDE CHAIN' 94 24 ARG A 46 ? ? 0.249 'SIDE CHAIN' 95 24 ARG A 53 ? ? 0.261 'SIDE CHAIN' 96 25 ARG A 9 ? ? 0.313 'SIDE CHAIN' 97 25 ARG A 13 ? ? 0.224 'SIDE CHAIN' 98 25 ARG A 46 ? ? 0.207 'SIDE CHAIN' 99 25 ARG A 53 ? ? 0.265 'SIDE CHAIN' 100 26 ARG A 9 ? ? 0.315 'SIDE CHAIN' 101 26 ARG A 13 ? ? 0.238 'SIDE CHAIN' 102 26 ARG A 46 ? ? 0.119 'SIDE CHAIN' 103 26 ARG A 53 ? ? 0.314 'SIDE CHAIN' 104 27 ARG A 9 ? ? 0.311 'SIDE CHAIN' 105 27 ARG A 13 ? ? 0.114 'SIDE CHAIN' 106 27 ARG A 46 ? ? 0.160 'SIDE CHAIN' 107 28 ARG A 9 ? ? 0.197 'SIDE CHAIN' 108 28 ARG A 53 ? ? 0.310 'SIDE CHAIN' 109 29 ARG A 9 ? ? 0.241 'SIDE CHAIN' 110 29 ARG A 13 ? ? 0.314 'SIDE CHAIN' 111 29 ARG A 46 ? ? 0.120 'SIDE CHAIN' 112 29 ARG A 53 ? ? 0.106 'SIDE CHAIN' 113 30 ARG A 9 ? ? 0.317 'SIDE CHAIN' 114 30 ARG A 13 ? ? 0.274 'SIDE CHAIN' 115 30 ARG A 46 ? ? 0.249 'SIDE CHAIN' 116 30 ARG A 53 ? ? 0.160 'SIDE CHAIN' 117 31 ARG A 9 ? ? 0.276 'SIDE CHAIN' 118 31 ARG A 13 ? ? 0.126 'SIDE CHAIN' 119 31 ARG A 46 ? ? 0.121 'SIDE CHAIN' 120 31 ARG A 53 ? ? 0.296 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A PRO -1 ? A PRO 2 3 2 Y 1 A GLY -2 ? A GLY 1 4 2 Y 1 A PRO -1 ? A PRO 2 5 3 Y 1 A GLY -2 ? A GLY 1 6 3 Y 1 A PRO -1 ? A PRO 2 7 4 Y 1 A GLY -2 ? A GLY 1 8 4 Y 1 A PRO -1 ? A PRO 2 9 5 Y 1 A GLY -2 ? A GLY 1 10 5 Y 1 A PRO -1 ? A PRO 2 11 6 Y 1 A GLY -2 ? A GLY 1 12 6 Y 1 A PRO -1 ? A PRO 2 13 7 Y 1 A GLY -2 ? A GLY 1 14 7 Y 1 A PRO -1 ? A PRO 2 15 8 Y 1 A GLY -2 ? A GLY 1 16 8 Y 1 A PRO -1 ? A PRO 2 17 9 Y 1 A GLY -2 ? A GLY 1 18 9 Y 1 A PRO -1 ? A PRO 2 19 10 Y 1 A GLY -2 ? A GLY 1 20 10 Y 1 A PRO -1 ? A PRO 2 21 11 Y 1 A GLY -2 ? A GLY 1 22 11 Y 1 A PRO -1 ? A PRO 2 23 12 Y 1 A GLY -2 ? A GLY 1 24 12 Y 1 A PRO -1 ? A PRO 2 25 13 Y 1 A GLY -2 ? A GLY 1 26 13 Y 1 A PRO -1 ? A PRO 2 27 14 Y 1 A GLY -2 ? A GLY 1 28 14 Y 1 A PRO -1 ? A PRO 2 29 15 Y 1 A GLY -2 ? A GLY 1 30 15 Y 1 A PRO -1 ? A PRO 2 31 16 Y 1 A GLY -2 ? A GLY 1 32 16 Y 1 A PRO -1 ? A PRO 2 33 17 Y 1 A GLY -2 ? A GLY 1 34 17 Y 1 A PRO -1 ? A PRO 2 35 18 Y 1 A GLY -2 ? A GLY 1 36 18 Y 1 A PRO -1 ? A PRO 2 37 19 Y 1 A GLY -2 ? A GLY 1 38 19 Y 1 A PRO -1 ? A PRO 2 39 20 Y 1 A GLY -2 ? A GLY 1 40 20 Y 1 A PRO -1 ? A PRO 2 41 21 Y 1 A GLY -2 ? A GLY 1 42 21 Y 1 A PRO -1 ? A PRO 2 43 22 Y 1 A GLY -2 ? A GLY 1 44 22 Y 1 A PRO -1 ? A PRO 2 45 23 Y 1 A GLY -2 ? A GLY 1 46 23 Y 1 A PRO -1 ? A PRO 2 47 24 Y 1 A GLY -2 ? A GLY 1 48 24 Y 1 A PRO -1 ? A PRO 2 49 25 Y 1 A GLY -2 ? A GLY 1 50 25 Y 1 A PRO -1 ? A PRO 2 51 26 Y 1 A GLY -2 ? A GLY 1 52 26 Y 1 A PRO -1 ? A PRO 2 53 27 Y 1 A GLY -2 ? A GLY 1 54 27 Y 1 A PRO -1 ? A PRO 2 55 28 Y 1 A GLY -2 ? A GLY 1 56 28 Y 1 A PRO -1 ? A PRO 2 57 29 Y 1 A GLY -2 ? A GLY 1 58 29 Y 1 A PRO -1 ? A PRO 2 59 30 Y 1 A GLY -2 ? A GLY 1 60 30 Y 1 A PRO -1 ? A PRO 2 61 31 Y 1 A GLY -2 ? A GLY 1 62 31 Y 1 A PRO -1 ? A PRO 2 #