data_1UZP # _entry.id 1UZP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UZP PDBE EBI-14803 WWPDB D_1290014803 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1APJ unspecified 'NMR STUDY OF THE TRANSFORMING GROWTH FACTOR BETA BINDINGPROTEIN-LIKE DOMAIN (TB MODULE/ 8-CYS DOMAIN), NMR,21 STRUCTURES' PDB 1EMN unspecified 'NMR STUDY OF A PAIR OF FIBRILLIN CA==2 +== BINDING EPIDERMAL GROWTH FACTOR-LIKE DOMAINS, MINIMIZED AVERAGE STRUCTURE' PDB 1EMO unspecified 'NMR STUDY OF A PAIR OF FIBRILLIN CA==2 +== BINDING EPIDERMAL GROWTH FACTOR-LIKE DOMAINS, 22 STRUCTURES' PDB 1LMJ unspecified 'NMR STUDY OF THE FIBRILLIN-1 CBEGF12-13 PAIR OF CA2+BINDING EPIDERMAL GROWTH FACTOR -LIKE DOMAINS' PDB 1UZK unspecified 'X_RAY STRUCTURE OF THE INTEGRIN BINDING CBEGF22-TB4-CBEGF33 FRAGMENT OF HUMAN FIBRILLIN-1, HOLO FORM' PDB 1UZJ unspecified 'X_RAY STRUCTURE OF THE INTEGRIN BINDING CBEGF22-TB4-CBEGF33 FRAGMENT OF HUMAN FIBRILLIN-1, HOLO FORM' PDB 1UZQ unspecified 'X_RAY STRUCTURE OF THE INTEGRIN BINDING CBEGF22-TB4-CBEGF33 FRAGMENT OF HUMAN FIBRILLIN-1, APO FORM CBEGF23' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UZP _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-03-15 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, S.S.J.' 1 ? 'Knott, V.' 2 ? 'Harlos, K.' 3 ? 'Handford, P.A.' 4 ? 'Stuart, D.I.' 5 ? # _citation.id primary _citation.title 'Structure of the Integrin Binding Fragment from Fibrillin-1 Gives New Insights Into Microfibril Organization' _citation.journal_abbrev Structure _citation.journal_volume 12 _citation.page_first 717 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15062093 _citation.pdbx_database_id_DOI 10.1016/J.STR.2004.02.023 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, S.S.J.' 1 ? primary 'Knott, V.' 2 ? primary 'Jovanovi, J.' 3 ? primary 'Harlos, K.' 4 ? primary 'Grimes, J.' 5 ? primary 'Choulier, L.' 6 ? primary 'Mardon, H.' 7 ? primary 'Stuart, D.I.' 8 ? primary 'Handford, P.A.' 9 ? # _cell.entry_id 1UZP _cell.length_a 42.500 _cell.length_b 65.100 _cell.length_c 102.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UZP _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man FIBRILLIN-1 17332.436 1 ? ? 'BEGF22-TB4-CBEGF23, RESIDUES 1486-1647' ? 2 non-polymer syn 'SAMARIUM (III) ION' 150.360 3 ? ? ? ? 3 water nat water 18.015 188 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCS LGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRV CD ; _entity_poly.pdbx_seq_one_letter_code_can ;TDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCS LGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRV CD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ASP n 1 3 VAL n 1 4 ASN n 1 5 GLU n 1 6 CYS n 1 7 LEU n 1 8 ASP n 1 9 PRO n 1 10 THR n 1 11 THR n 1 12 CYS n 1 13 ILE n 1 14 SER n 1 15 GLY n 1 16 ASN n 1 17 CYS n 1 18 VAL n 1 19 ASN n 1 20 THR n 1 21 PRO n 1 22 GLY n 1 23 SER n 1 24 TYR n 1 25 ILE n 1 26 CYS n 1 27 ASP n 1 28 CYS n 1 29 PRO n 1 30 PRO n 1 31 ASP n 1 32 PHE n 1 33 GLU n 1 34 LEU n 1 35 ASN n 1 36 PRO n 1 37 THR n 1 38 ARG n 1 39 VAL n 1 40 GLY n 1 41 CYS n 1 42 VAL n 1 43 ASP n 1 44 THR n 1 45 ARG n 1 46 SER n 1 47 GLY n 1 48 ASN n 1 49 CYS n 1 50 TYR n 1 51 LEU n 1 52 ASP n 1 53 ILE n 1 54 ARG n 1 55 PRO n 1 56 ARG n 1 57 GLY n 1 58 ASP n 1 59 ASN n 1 60 GLY n 1 61 ASP n 1 62 THR n 1 63 ALA n 1 64 CYS n 1 65 SER n 1 66 ASN n 1 67 GLU n 1 68 ILE n 1 69 GLY n 1 70 VAL n 1 71 GLY n 1 72 VAL n 1 73 SER n 1 74 LYS n 1 75 ALA n 1 76 SER n 1 77 CYS n 1 78 CYS n 1 79 CYS n 1 80 SER n 1 81 LEU n 1 82 GLY n 1 83 LYS n 1 84 ALA n 1 85 TRP n 1 86 GLY n 1 87 THR n 1 88 PRO n 1 89 CYS n 1 90 GLU n 1 91 MET n 1 92 CYS n 1 93 PRO n 1 94 ALA n 1 95 VAL n 1 96 ASN n 1 97 THR n 1 98 SER n 1 99 GLU n 1 100 TYR n 1 101 LYS n 1 102 ILE n 1 103 LEU n 1 104 CYS n 1 105 PRO n 1 106 GLY n 1 107 GLY n 1 108 GLU n 1 109 GLY n 1 110 PHE n 1 111 ARG n 1 112 PRO n 1 113 ASN n 1 114 PRO n 1 115 ILE n 1 116 THR n 1 117 VAL n 1 118 ILE n 1 119 LEU n 1 120 GLU n 1 121 ASP n 1 122 ILE n 1 123 ASP n 1 124 GLU n 1 125 CYS n 1 126 GLN n 1 127 GLU n 1 128 LEU n 1 129 PRO n 1 130 GLY n 1 131 LEU n 1 132 CYS n 1 133 GLN n 1 134 GLY n 1 135 GLY n 1 136 LYS n 1 137 CYS n 1 138 ILE n 1 139 ASN n 1 140 THR n 1 141 PHE n 1 142 GLY n 1 143 SER n 1 144 PHE n 1 145 GLN n 1 146 CYS n 1 147 ARG n 1 148 CYS n 1 149 PRO n 1 150 THR n 1 151 GLY n 1 152 TYR n 1 153 TYR n 1 154 LEU n 1 155 ASN n 1 156 GLU n 1 157 ASP n 1 158 THR n 1 159 ARG n 1 160 VAL n 1 161 CYS n 1 162 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue 'EXTRA-ELLULAR MATRIX' _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain NM554 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FBN1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P35555 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UZP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35555 _struct_ref_seq.db_align_beg 1486 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1647 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1486 _struct_ref_seq.pdbx_auth_seq_align_end 1647 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SM non-polymer . 'SAMARIUM (III) ION' ? 'Sm 3' 150.360 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1UZP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_percent_sol 36 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;SITTING DROP VAPOUR DIFFUSION, 3 MICROLITRE OF 25MG/ML PROTEIN, 10MM TRIS PH7.5 + 0.5 MICROLITRES OF 40% V/V POLYPROPYLENE GLYCOL P400 + 2.5 MICROLITRES RESERVOIR SOLUTION (0.2M LISULFATE, 0.1M TRIS PH 8.5, 30% PEG 4000) SOAKED OVERNIGHT IN 10MM SAMARIUM ACETATE ; # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MARRESEARCH 300MM' _diffrn_detector.pdbx_collection_date 2001-09-15 _diffrn_detector.details 'OSMIC BLUE CONFOCAL' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.542 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU345' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.542 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1UZP _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.000 _reflns.d_resolution_high 1.780 _reflns.number_obs 13997 _reflns.number_all ? _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.12700 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 24.4000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 25.200 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.78 _reflns_shell.d_res_low 1.84 _reflns_shell.percent_possible_all 98.6 _reflns_shell.Rmerge_I_obs 0.47900 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.300 _reflns_shell.pdbx_redundancy ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1UZP _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 6275 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 1.78 _refine.ls_percent_reflns_obs 99.0 _refine.ls_R_factor_obs 0.210 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.210 _refine.ls_R_factor_R_free 0.254 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.9 _refine.ls_number_reflns_R_free 1385 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 10.0 _refine.aniso_B[2][2] -19.5 _refine.aniso_B[3][3] 9.5 _refine.aniso_B[1][2] 0.0 _refine.aniso_B[1][3] 0.0 _refine.aniso_B[2][3] 0.0 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.365 _refine.solvent_model_param_bsol 49 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1122 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 188 _refine_hist.number_atoms_total 1313 _refine_hist.d_res_high 1.78 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.78 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 3.1 3.0 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 4.7 4.0 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 3.8 4.0 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 6.1 5.0 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 27 _refine_ls_shell.d_res_high 1.78 _refine_ls_shell.d_res_low 1.8 _refine_ls_shell.number_reflns_R_work 369 _refine_ls_shell.R_factor_R_work 0.50 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.516 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 1UZP _struct.title 'Integrin binding cbEGF22-TB4-cbEGF33 fragment of human fibrillin-1, Sm bound form cbEGF23 domain only.' _struct.pdbx_descriptor FIBRILLIN-1 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UZP _struct_keywords.pdbx_keywords 'MATRIX PROTEIN' _struct_keywords.text 'MATRIX PROTEIN, EXTRA-CELLULAR MATRIX, FIBRILLIN-1, CBEGF DOMAIN, TB DOMAIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 4 ? ASP A 8 ? ASN A 1489 ASP A 1493 5 ? 5 HELX_P HELX_P2 2 SER A 73 ? CYS A 79 ? SER A 1558 CYS A 1564 1 ? 7 HELX_P HELX_P3 3 THR A 97 ? CYS A 104 ? THR A 1582 CYS A 1589 1 ? 8 HELX_P HELX_P4 4 ASP A 123 ? LEU A 128 ? ASP A 1608 LEU A 1613 1 ? 6 HELX_P HELX_P5 5 PRO A 129 ? CYS A 132 ? PRO A 1614 CYS A 1617 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 1491 A CYS 1502 1_555 ? ? ? ? ? ? ? 2.043 ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 1497 A CYS 1511 1_555 ? ? ? ? ? ? ? 2.039 ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 1513 A CYS 1526 1_555 ? ? ? ? ? ? ? 2.049 ? disulf4 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 1534 A CYS 1562 1_555 ? ? ? ? ? ? ? 2.042 ? disulf5 disulf ? ? A CYS 64 SG ? ? ? 1_555 A CYS 89 SG ? ? A CYS 1549 A CYS 1574 1_555 ? ? ? ? ? ? ? 2.028 ? disulf6 disulf ? ? A CYS 78 SG ? ? ? 1_555 A CYS 92 SG ? ? A CYS 1563 A CYS 1577 1_555 ? ? ? ? ? ? ? 2.046 ? disulf7 disulf ? ? A CYS 79 SG ? ? ? 1_555 A CYS 104 SG ? ? A CYS 1564 A CYS 1589 1_555 ? ? ? ? ? ? ? 2.031 ? disulf8 disulf ? ? A CYS 125 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 1610 A CYS 1622 1_555 ? ? ? ? ? ? ? 2.039 ? disulf9 disulf ? ? A CYS 132 SG ? ? ? 1_555 A CYS 146 SG ? ? A CYS 1617 A CYS 1631 1_555 ? ? ? ? ? ? ? 2.026 ? disulf10 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 161 SG ? ? A CYS 1633 A CYS 1646 1_555 ? ? ? ? ? ? ? 2.042 ? metalc1 metalc ? ? A ASP 2 OD1 ? ? ? 1_555 B SM . SM ? ? A ASP 1487 A SM 2648 1_555 ? ? ? ? ? ? ? 2.310 ? metalc2 metalc ? ? A ASP 2 OD2 ? ? ? 1_555 B SM . SM ? ? A ASP 1487 A SM 2648 1_555 ? ? ? ? ? ? ? 2.608 ? metalc3 metalc ? ? A VAL 3 O ? ? ? 1_555 B SM . SM ? ? A VAL 1488 A SM 2648 1_555 ? ? ? ? ? ? ? 2.300 ? metalc4 metalc ? ? A GLU 5 OE1 ? ? ? 1_555 B SM . SM ? ? A GLU 1490 A SM 2648 1_555 ? ? ? ? ? ? ? 2.538 ? metalc5 metalc ? ? A GLU 5 OE2 ? ? ? 1_555 B SM . SM ? ? A GLU 1490 A SM 2648 1_555 ? ? ? ? ? ? ? 2.854 ? metalc6 metalc ? ? A ASN 19 OD1 ? ? ? 1_555 B SM . SM ? ? A ASN 1504 A SM 2648 1_555 ? ? ? ? ? ? ? 2.358 ? metalc7 metalc ? ? A THR 20 O ? ? ? 1_555 B SM . SM ? ? A THR 1505 A SM 2648 1_555 ? ? ? ? ? ? ? 2.400 ? metalc8 metalc ? ? A GLY 22 O ? ? ? 1_555 B SM . SM ? ? A GLY 1507 A SM 2648 1_555 ? ? ? ? ? ? ? 2.552 ? metalc9 metalc ? ? A SER 23 O ? ? ? 1_555 B SM . SM ? ? A SER 1508 A SM 2648 1_555 ? ? ? ? ? ? ? 2.348 ? metalc10 metalc ? ? A GLU 99 OE2 ? ? ? 1_555 D SM . SM ? ? A GLU 1584 A SM 2650 1_555 ? ? ? ? ? ? ? 2.319 ? metalc11 metalc ? ? A ASP 121 OD1 ? ? ? 1_555 C SM . SM ? ? A ASP 1606 A SM 2649 1_555 ? ? ? ? ? ? ? 2.517 ? metalc12 metalc ? ? A ASP 121 OD2 ? ? ? 1_555 C SM . SM ? ? A ASP 1606 A SM 2649 1_555 ? ? ? ? ? ? ? 2.467 ? metalc13 metalc ? ? A ILE 122 O ? ? ? 1_555 C SM . SM ? ? A ILE 1607 A SM 2649 1_555 ? ? ? ? ? ? ? 2.273 ? metalc14 metalc ? ? A GLU 124 OE2 ? ? ? 1_555 C SM . SM ? ? A GLU 1609 A SM 2649 1_555 ? ? ? ? ? ? ? 2.247 ? metalc15 metalc ? ? A ASN 139 OD1 ? ? ? 1_555 C SM . SM ? ? A ASN 1624 A SM 2649 1_555 ? ? ? ? ? ? ? 2.280 ? metalc16 metalc ? ? A THR 140 O ? ? ? 1_555 C SM . SM ? ? A THR 1625 A SM 2649 1_555 ? ? ? ? ? ? ? 2.456 ? metalc17 metalc ? ? A SER 143 O ? ? ? 1_555 C SM . SM ? ? A SER 1628 A SM 2649 1_555 ? ? ? ? ? ? ? 2.419 ? metalc18 metalc ? ? C SM . SM ? ? ? 1_555 E HOH . O ? ? A SM 2649 A HOH 2138 1_555 ? ? ? ? ? ? ? 2.556 ? metalc19 metalc ? ? A GLU 99 OE1 ? ? ? 1_555 D SM . SM ? ? A GLU 1584 A SM 2650 3_656 ? ? ? ? ? ? ? 2.754 ? metalc20 metalc ? ? A GLU 99 OE2 ? ? ? 1_555 D SM . SM ? ? A GLU 1584 A SM 2650 3_656 ? ? ? ? ? ? ? 2.537 ? metalc21 metalc ? ? D SM . SM ? ? ? 1_555 E HOH . O ? ? A SM 2650 A HOH 2109 3_656 ? ? ? ? ? ? ? 2.521 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 87 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 1572 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 88 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1573 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 2 ? AB ? 2 ? AC ? 4 ? AD ? 2 ? AE ? 2 ? AF ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AD 1 2 ? anti-parallel AE 1 2 ? anti-parallel AF 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ASN A 16 ? ASN A 19 ? ASN A 1501 ASN A 1504 AA 2 TYR A 24 ? ASP A 27 ? TYR A 1509 ASP A 1512 AB 1 GLU A 33 ? LEU A 34 ? GLU A 1518 LEU A 1519 AB 2 CYS A 41 ? VAL A 42 ? CYS A 1526 VAL A 1527 AC 1 SER A 65 ? VAL A 72 ? SER A 1550 VAL A 1557 AC 2 GLY A 47 ? ASP A 52 ? GLY A 1532 ASP A 1537 AC 3 ALA A 84 ? TRP A 85 ? ALA A 1569 TRP A 1570 AC 4 GLU A 90 ? MET A 91 ? GLU A 1575 MET A 1576 AD 1 PHE A 110 ? PRO A 112 ? PHE A 1595 PRO A 1597 AD 2 LEU A 119 ? ASP A 121 ? LEU A 1604 ASP A 1606 AE 1 LYS A 136 ? THR A 140 ? LYS A 1621 THR A 1625 AE 2 SER A 143 ? ARG A 147 ? SER A 1628 ARG A 1632 AF 1 LEU A 154 ? ASN A 155 ? LEU A 1639 ASN A 1640 AF 2 VAL A 160 ? CYS A 161 ? VAL A 1645 CYS A 1646 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N VAL A 18 ? N VAL A 1503 O ILE A 25 ? O ILE A 1510 AB 1 2 N GLU A 33 ? N GLU A 1518 O VAL A 42 ? O VAL A 1527 AC 1 2 N VAL A 72 ? N VAL A 1557 O GLY A 47 ? O GLY A 1532 AC 2 3 N TYR A 50 ? N TYR A 1535 O ALA A 84 ? O ALA A 1569 AC 3 4 N TRP A 85 ? N TRP A 1570 O GLU A 90 ? O GLU A 1575 AD 1 2 N ARG A 111 ? N ARG A 1596 O GLU A 120 ? O GLU A 1605 AE 1 2 N THR A 140 ? N THR A 1625 O SER A 143 ? O SER A 1628 AF 1 2 N ASN A 155 ? N ASN A 1640 O VAL A 160 ? O VAL A 1645 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SM A2648' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SM A2649' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SM A2650' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 2 ? ASP A 1487 . ? 1_555 ? 2 AC1 7 VAL A 3 ? VAL A 1488 . ? 1_555 ? 3 AC1 7 GLU A 5 ? GLU A 1490 . ? 1_555 ? 4 AC1 7 ASN A 19 ? ASN A 1504 . ? 1_555 ? 5 AC1 7 THR A 20 ? THR A 1505 . ? 1_555 ? 6 AC1 7 GLY A 22 ? GLY A 1507 . ? 1_555 ? 7 AC1 7 SER A 23 ? SER A 1508 . ? 1_555 ? 8 AC2 7 ASP A 121 ? ASP A 1606 . ? 1_555 ? 9 AC2 7 ILE A 122 ? ILE A 1607 . ? 1_555 ? 10 AC2 7 GLU A 124 ? GLU A 1609 . ? 1_555 ? 11 AC2 7 ASN A 139 ? ASN A 1624 . ? 1_555 ? 12 AC2 7 THR A 140 ? THR A 1625 . ? 1_555 ? 13 AC2 7 SER A 143 ? SER A 1628 . ? 1_555 ? 14 AC2 7 HOH E . ? HOH A 2138 . ? 1_555 ? 15 AC3 2 GLU A 99 ? GLU A 1584 . ? 1_555 ? 16 AC3 2 HOH E . ? HOH A 2109 . ? 1_555 ? # _database_PDB_matrix.entry_id 1UZP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UZP _atom_sites.fract_transf_matrix[1][1] 0.023529 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015361 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009775 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SM # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1486 1486 THR THR A . n A 1 2 ASP 2 1487 1487 ASP ASP A . n A 1 3 VAL 3 1488 1488 VAL VAL A . n A 1 4 ASN 4 1489 1489 ASN ASN A . n A 1 5 GLU 5 1490 1490 GLU GLU A . n A 1 6 CYS 6 1491 1491 CYS CYS A . n A 1 7 LEU 7 1492 1492 LEU LEU A . n A 1 8 ASP 8 1493 1493 ASP ASP A . n A 1 9 PRO 9 1494 1494 PRO PRO A . n A 1 10 THR 10 1495 1495 THR THR A . n A 1 11 THR 11 1496 1496 THR THR A . n A 1 12 CYS 12 1497 1497 CYS CYS A . n A 1 13 ILE 13 1498 1498 ILE ILE A . n A 1 14 SER 14 1499 1499 SER SER A . n A 1 15 GLY 15 1500 1500 GLY GLY A . n A 1 16 ASN 16 1501 1501 ASN ASN A . n A 1 17 CYS 17 1502 1502 CYS CYS A . n A 1 18 VAL 18 1503 1503 VAL VAL A . n A 1 19 ASN 19 1504 1504 ASN ASN A . n A 1 20 THR 20 1505 1505 THR THR A . n A 1 21 PRO 21 1506 1506 PRO PRO A . n A 1 22 GLY 22 1507 1507 GLY GLY A . n A 1 23 SER 23 1508 1508 SER SER A . n A 1 24 TYR 24 1509 1509 TYR TYR A . n A 1 25 ILE 25 1510 1510 ILE ILE A . n A 1 26 CYS 26 1511 1511 CYS CYS A . n A 1 27 ASP 27 1512 1512 ASP ASP A . n A 1 28 CYS 28 1513 1513 CYS CYS A . n A 1 29 PRO 29 1514 1514 PRO PRO A . n A 1 30 PRO 30 1515 1515 PRO PRO A . n A 1 31 ASP 31 1516 1516 ASP ASP A . n A 1 32 PHE 32 1517 1517 PHE PHE A . n A 1 33 GLU 33 1518 1518 GLU GLU A . n A 1 34 LEU 34 1519 1519 LEU LEU A . n A 1 35 ASN 35 1520 1520 ASN ASN A . n A 1 36 PRO 36 1521 1521 PRO PRO A . n A 1 37 THR 37 1522 1522 THR THR A . n A 1 38 ARG 38 1523 1523 ARG ARG A . n A 1 39 VAL 39 1524 1524 VAL VAL A . n A 1 40 GLY 40 1525 1525 GLY GLY A . n A 1 41 CYS 41 1526 1526 CYS CYS A . n A 1 42 VAL 42 1527 1527 VAL VAL A . n A 1 43 ASP 43 1528 1528 ASP ASP A . n A 1 44 THR 44 1529 1529 THR THR A . n A 1 45 ARG 45 1530 1530 ARG ARG A . n A 1 46 SER 46 1531 1531 SER SER A . n A 1 47 GLY 47 1532 1532 GLY GLY A . n A 1 48 ASN 48 1533 1533 ASN ASN A . n A 1 49 CYS 49 1534 1534 CYS CYS A . n A 1 50 TYR 50 1535 1535 TYR TYR A . n A 1 51 LEU 51 1536 1536 LEU LEU A . n A 1 52 ASP 52 1537 1537 ASP ASP A . n A 1 53 ILE 53 1538 1538 ILE ILE A . n A 1 54 ARG 54 1539 ? ? ? A . n A 1 55 PRO 55 1540 ? ? ? A . n A 1 56 ARG 56 1541 ? ? ? A . n A 1 57 GLY 57 1542 ? ? ? A . n A 1 58 ASP 58 1543 ? ? ? A . n A 1 59 ASN 59 1544 ? ? ? A . n A 1 60 GLY 60 1545 ? ? ? A . n A 1 61 ASP 61 1546 ? ? ? A . n A 1 62 THR 62 1547 ? ? ? A . n A 1 63 ALA 63 1548 ? ? ? A . n A 1 64 CYS 64 1549 1549 CYS CYS A . n A 1 65 SER 65 1550 1550 SER SER A . n A 1 66 ASN 66 1551 1551 ASN ASN A . n A 1 67 GLU 67 1552 1552 GLU GLU A . n A 1 68 ILE 68 1553 1553 ILE ILE A . n A 1 69 GLY 69 1554 1554 GLY GLY A . n A 1 70 VAL 70 1555 1555 VAL VAL A . n A 1 71 GLY 71 1556 1556 GLY GLY A . n A 1 72 VAL 72 1557 1557 VAL VAL A . n A 1 73 SER 73 1558 1558 SER SER A . n A 1 74 LYS 74 1559 1559 LYS LYS A . n A 1 75 ALA 75 1560 1560 ALA ALA A . n A 1 76 SER 76 1561 1561 SER SER A . n A 1 77 CYS 77 1562 1562 CYS CYS A . n A 1 78 CYS 78 1563 1563 CYS CYS A . n A 1 79 CYS 79 1564 1564 CYS CYS A . n A 1 80 SER 80 1565 1565 SER SER A . n A 1 81 LEU 81 1566 1566 LEU LEU A . n A 1 82 GLY 82 1567 1567 GLY GLY A . n A 1 83 LYS 83 1568 1568 LYS LYS A . n A 1 84 ALA 84 1569 1569 ALA ALA A . n A 1 85 TRP 85 1570 1570 TRP TRP A . n A 1 86 GLY 86 1571 1571 GLY GLY A . n A 1 87 THR 87 1572 1572 THR THR A . n A 1 88 PRO 88 1573 1573 PRO PRO A . n A 1 89 CYS 89 1574 1574 CYS CYS A . n A 1 90 GLU 90 1575 1575 GLU GLU A . n A 1 91 MET 91 1576 1576 MET MET A . n A 1 92 CYS 92 1577 1577 CYS CYS A . n A 1 93 PRO 93 1578 1578 PRO PRO A . n A 1 94 ALA 94 1579 1579 ALA ALA A . n A 1 95 VAL 95 1580 1580 VAL VAL A . n A 1 96 ASN 96 1581 1581 ASN ASN A . n A 1 97 THR 97 1582 1582 THR THR A . n A 1 98 SER 98 1583 1583 SER SER A . n A 1 99 GLU 99 1584 1584 GLU GLU A . n A 1 100 TYR 100 1585 1585 TYR TYR A . n A 1 101 LYS 101 1586 1586 LYS LYS A . n A 1 102 ILE 102 1587 1587 ILE ILE A . n A 1 103 LEU 103 1588 1588 LEU LEU A . n A 1 104 CYS 104 1589 1589 CYS CYS A . n A 1 105 PRO 105 1590 1590 PRO PRO A . n A 1 106 GLY 106 1591 1591 GLY GLY A . n A 1 107 GLY 107 1592 1592 GLY GLY A . n A 1 108 GLU 108 1593 1593 GLU GLU A . n A 1 109 GLY 109 1594 1594 GLY GLY A . n A 1 110 PHE 110 1595 1595 PHE PHE A . n A 1 111 ARG 111 1596 1596 ARG ARG A . n A 1 112 PRO 112 1597 1597 PRO PRO A . n A 1 113 ASN 113 1598 1598 ASN ASN A . n A 1 114 PRO 114 1599 1599 PRO PRO A . n A 1 115 ILE 115 1600 1600 ILE ILE A . n A 1 116 THR 116 1601 1601 THR THR A . n A 1 117 VAL 117 1602 1602 VAL VAL A . n A 1 118 ILE 118 1603 1603 ILE ILE A . n A 1 119 LEU 119 1604 1604 LEU LEU A . n A 1 120 GLU 120 1605 1605 GLU GLU A . n A 1 121 ASP 121 1606 1606 ASP ASP A . n A 1 122 ILE 122 1607 1607 ILE ILE A . n A 1 123 ASP 123 1608 1608 ASP ASP A . n A 1 124 GLU 124 1609 1609 GLU GLU A . n A 1 125 CYS 125 1610 1610 CYS CYS A . n A 1 126 GLN 126 1611 1611 GLN GLN A . n A 1 127 GLU 127 1612 1612 GLU GLU A . n A 1 128 LEU 128 1613 1613 LEU LEU A . n A 1 129 PRO 129 1614 1614 PRO PRO A . n A 1 130 GLY 130 1615 1615 GLY GLY A . n A 1 131 LEU 131 1616 1616 LEU LEU A . n A 1 132 CYS 132 1617 1617 CYS CYS A . n A 1 133 GLN 133 1618 1618 GLN GLN A . n A 1 134 GLY 134 1619 1619 GLY GLY A . n A 1 135 GLY 135 1620 1620 GLY GLY A . n A 1 136 LYS 136 1621 1621 LYS LYS A . n A 1 137 CYS 137 1622 1622 CYS CYS A . n A 1 138 ILE 138 1623 1623 ILE ILE A . n A 1 139 ASN 139 1624 1624 ASN ASN A . n A 1 140 THR 140 1625 1625 THR THR A . n A 1 141 PHE 141 1626 1626 PHE PHE A . n A 1 142 GLY 142 1627 1627 GLY GLY A . n A 1 143 SER 143 1628 1628 SER SER A . n A 1 144 PHE 144 1629 1629 PHE PHE A . n A 1 145 GLN 145 1630 1630 GLN GLN A . n A 1 146 CYS 146 1631 1631 CYS CYS A . n A 1 147 ARG 147 1632 1632 ARG ARG A . n A 1 148 CYS 148 1633 1633 CYS CYS A . n A 1 149 PRO 149 1634 1634 PRO PRO A . n A 1 150 THR 150 1635 1635 THR THR A . n A 1 151 GLY 151 1636 1636 GLY GLY A . n A 1 152 TYR 152 1637 1637 TYR TYR A . n A 1 153 TYR 153 1638 1638 TYR TYR A . n A 1 154 LEU 154 1639 1639 LEU LEU A . n A 1 155 ASN 155 1640 1640 ASN ASN A . n A 1 156 GLU 156 1641 1641 GLU GLU A . n A 1 157 ASP 157 1642 1642 ASP ASP A . n A 1 158 THR 158 1643 1643 THR THR A . n A 1 159 ARG 159 1644 1644 ARG ARG A . n A 1 160 VAL 160 1645 1645 VAL VAL A . n A 1 161 CYS 161 1646 1646 CYS CYS A . n A 1 162 ASP 162 1647 1647 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SM 1 2648 2648 SM SM A . C 2 SM 1 2649 2649 SM SM A . D 2 SM 1 2650 2650 SM SM A . E 3 HOH 1 2001 2001 HOH HOH A . E 3 HOH 2 2002 2002 HOH HOH A . E 3 HOH 3 2003 2003 HOH HOH A . E 3 HOH 4 2004 2004 HOH HOH A . E 3 HOH 5 2005 2005 HOH HOH A . E 3 HOH 6 2006 2006 HOH HOH A . E 3 HOH 7 2007 2007 HOH HOH A . E 3 HOH 8 2008 2008 HOH HOH A . E 3 HOH 9 2009 2009 HOH HOH A . E 3 HOH 10 2010 2010 HOH HOH A . E 3 HOH 11 2011 2011 HOH HOH A . E 3 HOH 12 2012 2012 HOH HOH A . E 3 HOH 13 2013 2013 HOH HOH A . E 3 HOH 14 2014 2014 HOH HOH A . E 3 HOH 15 2015 2015 HOH HOH A . E 3 HOH 16 2016 2016 HOH HOH A . E 3 HOH 17 2017 2017 HOH HOH A . E 3 HOH 18 2018 2018 HOH HOH A . E 3 HOH 19 2019 2019 HOH HOH A . E 3 HOH 20 2020 2020 HOH HOH A . E 3 HOH 21 2021 2021 HOH HOH A . E 3 HOH 22 2022 2022 HOH HOH A . E 3 HOH 23 2023 2023 HOH HOH A . E 3 HOH 24 2024 2024 HOH HOH A . E 3 HOH 25 2025 2025 HOH HOH A . E 3 HOH 26 2026 2026 HOH HOH A . E 3 HOH 27 2027 2027 HOH HOH A . E 3 HOH 28 2028 2028 HOH HOH A . E 3 HOH 29 2029 2029 HOH HOH A . E 3 HOH 30 2030 2030 HOH HOH A . E 3 HOH 31 2031 2031 HOH HOH A . E 3 HOH 32 2032 2032 HOH HOH A . E 3 HOH 33 2033 2033 HOH HOH A . E 3 HOH 34 2034 2034 HOH HOH A . E 3 HOH 35 2035 2035 HOH HOH A . E 3 HOH 36 2036 2036 HOH HOH A . E 3 HOH 37 2037 2037 HOH HOH A . E 3 HOH 38 2038 2038 HOH HOH A . E 3 HOH 39 2039 2039 HOH HOH A . E 3 HOH 40 2040 2040 HOH HOH A . E 3 HOH 41 2041 2041 HOH HOH A . E 3 HOH 42 2042 2042 HOH HOH A . E 3 HOH 43 2043 2043 HOH HOH A . E 3 HOH 44 2044 2044 HOH HOH A . E 3 HOH 45 2045 2045 HOH HOH A . E 3 HOH 46 2046 2046 HOH HOH A . E 3 HOH 47 2047 2047 HOH HOH A . E 3 HOH 48 2048 2048 HOH HOH A . E 3 HOH 49 2049 2049 HOH HOH A . E 3 HOH 50 2050 2050 HOH HOH A . E 3 HOH 51 2051 2051 HOH HOH A . E 3 HOH 52 2052 2052 HOH HOH A . E 3 HOH 53 2053 2053 HOH HOH A . E 3 HOH 54 2054 2054 HOH HOH A . E 3 HOH 55 2055 2055 HOH HOH A . E 3 HOH 56 2056 2056 HOH HOH A . E 3 HOH 57 2057 2057 HOH HOH A . E 3 HOH 58 2058 2058 HOH HOH A . E 3 HOH 59 2059 2059 HOH HOH A . E 3 HOH 60 2060 2060 HOH HOH A . E 3 HOH 61 2061 2061 HOH HOH A . E 3 HOH 62 2062 2062 HOH HOH A . E 3 HOH 63 2063 2063 HOH HOH A . E 3 HOH 64 2064 2064 HOH HOH A . E 3 HOH 65 2065 2065 HOH HOH A . E 3 HOH 66 2066 2066 HOH HOH A . E 3 HOH 67 2067 2067 HOH HOH A . E 3 HOH 68 2068 2068 HOH HOH A . E 3 HOH 69 2069 2069 HOH HOH A . E 3 HOH 70 2070 2070 HOH HOH A . E 3 HOH 71 2071 2071 HOH HOH A . E 3 HOH 72 2072 2072 HOH HOH A . E 3 HOH 73 2073 2073 HOH HOH A . E 3 HOH 74 2074 2074 HOH HOH A . E 3 HOH 75 2075 2075 HOH HOH A . E 3 HOH 76 2076 2076 HOH HOH A . E 3 HOH 77 2077 2077 HOH HOH A . E 3 HOH 78 2078 2078 HOH HOH A . E 3 HOH 79 2079 2079 HOH HOH A . E 3 HOH 80 2080 2080 HOH HOH A . E 3 HOH 81 2081 2081 HOH HOH A . E 3 HOH 82 2082 2082 HOH HOH A . E 3 HOH 83 2083 2083 HOH HOH A . E 3 HOH 84 2084 2084 HOH HOH A . E 3 HOH 85 2085 2085 HOH HOH A . E 3 HOH 86 2086 2086 HOH HOH A . E 3 HOH 87 2087 2087 HOH HOH A . E 3 HOH 88 2088 2088 HOH HOH A . E 3 HOH 89 2089 2089 HOH HOH A . E 3 HOH 90 2090 2090 HOH HOH A . E 3 HOH 91 2091 2091 HOH HOH A . E 3 HOH 92 2092 2092 HOH HOH A . E 3 HOH 93 2093 2093 HOH HOH A . E 3 HOH 94 2094 2094 HOH HOH A . E 3 HOH 95 2095 2095 HOH HOH A . E 3 HOH 96 2096 2096 HOH HOH A . E 3 HOH 97 2097 2097 HOH HOH A . E 3 HOH 98 2098 2098 HOH HOH A . E 3 HOH 99 2099 2099 HOH HOH A . E 3 HOH 100 2100 2100 HOH HOH A . E 3 HOH 101 2101 2101 HOH HOH A . E 3 HOH 102 2102 2102 HOH HOH A . E 3 HOH 103 2103 2103 HOH HOH A . E 3 HOH 104 2104 2104 HOH HOH A . E 3 HOH 105 2105 2105 HOH HOH A . E 3 HOH 106 2106 2106 HOH HOH A . E 3 HOH 107 2107 2107 HOH HOH A . E 3 HOH 108 2108 2108 HOH HOH A . E 3 HOH 109 2109 2109 HOH HOH A . E 3 HOH 110 2110 2110 HOH HOH A . E 3 HOH 111 2111 2111 HOH HOH A . E 3 HOH 112 2112 2112 HOH HOH A . E 3 HOH 113 2113 2113 HOH HOH A . E 3 HOH 114 2114 2114 HOH HOH A . E 3 HOH 115 2115 2115 HOH HOH A . E 3 HOH 116 2116 2116 HOH HOH A . E 3 HOH 117 2117 2117 HOH HOH A . E 3 HOH 118 2118 2118 HOH HOH A . E 3 HOH 119 2119 2119 HOH HOH A . E 3 HOH 120 2120 2120 HOH HOH A . E 3 HOH 121 2121 2121 HOH HOH A . E 3 HOH 122 2122 2122 HOH HOH A . E 3 HOH 123 2123 2123 HOH HOH A . E 3 HOH 124 2124 2124 HOH HOH A . E 3 HOH 125 2125 2125 HOH HOH A . E 3 HOH 126 2126 2126 HOH HOH A . E 3 HOH 127 2127 2127 HOH HOH A . E 3 HOH 128 2128 2128 HOH HOH A . E 3 HOH 129 2129 2129 HOH HOH A . E 3 HOH 130 2130 2130 HOH HOH A . E 3 HOH 131 2131 2131 HOH HOH A . E 3 HOH 132 2132 2132 HOH HOH A . E 3 HOH 133 2133 2133 HOH HOH A . E 3 HOH 134 2134 2134 HOH HOH A . E 3 HOH 135 2135 2135 HOH HOH A . E 3 HOH 136 2136 2136 HOH HOH A . E 3 HOH 137 2137 2137 HOH HOH A . E 3 HOH 138 2138 2138 HOH HOH A . E 3 HOH 139 2139 2139 HOH HOH A . E 3 HOH 140 2140 2140 HOH HOH A . E 3 HOH 141 2141 2141 HOH HOH A . E 3 HOH 142 2142 2142 HOH HOH A . E 3 HOH 143 2143 2143 HOH HOH A . E 3 HOH 144 2144 2144 HOH HOH A . E 3 HOH 145 2145 2145 HOH HOH A . E 3 HOH 146 2146 2146 HOH HOH A . E 3 HOH 147 2147 2147 HOH HOH A . E 3 HOH 148 2148 2148 HOH HOH A . E 3 HOH 149 2149 2149 HOH HOH A . E 3 HOH 150 2150 2150 HOH HOH A . E 3 HOH 151 2151 2151 HOH HOH A . E 3 HOH 152 2152 2152 HOH HOH A . E 3 HOH 153 2153 2153 HOH HOH A . E 3 HOH 154 2154 2154 HOH HOH A . E 3 HOH 155 2155 2155 HOH HOH A . E 3 HOH 156 2156 2156 HOH HOH A . E 3 HOH 157 2157 2157 HOH HOH A . E 3 HOH 158 2158 2158 HOH HOH A . E 3 HOH 159 2159 2159 HOH HOH A . E 3 HOH 160 2160 2160 HOH HOH A . E 3 HOH 161 2161 2161 HOH HOH A . E 3 HOH 162 2162 2162 HOH HOH A . E 3 HOH 163 2163 2163 HOH HOH A . E 3 HOH 164 2164 2164 HOH HOH A . E 3 HOH 165 2165 2165 HOH HOH A . E 3 HOH 166 2166 2166 HOH HOH A . E 3 HOH 167 2167 2167 HOH HOH A . E 3 HOH 168 2168 2168 HOH HOH A . E 3 HOH 169 2169 2169 HOH HOH A . E 3 HOH 170 2170 2170 HOH HOH A . E 3 HOH 171 2171 2171 HOH HOH A . E 3 HOH 172 2172 2172 HOH HOH A . E 3 HOH 173 2173 2173 HOH HOH A . E 3 HOH 174 2174 2174 HOH HOH A . E 3 HOH 175 2175 2175 HOH HOH A . E 3 HOH 176 2176 2176 HOH HOH A . E 3 HOH 177 2177 2177 HOH HOH A . E 3 HOH 178 2178 2178 HOH HOH A . E 3 HOH 179 2179 2179 HOH HOH A . E 3 HOH 180 2180 2180 HOH HOH A . E 3 HOH 181 2181 2181 HOH HOH A . E 3 HOH 182 2182 2182 HOH HOH A . E 3 HOH 183 2183 2183 HOH HOH A . E 3 HOH 184 2184 2184 HOH HOH A . E 3 HOH 185 2185 2185 HOH HOH A . E 3 HOH 186 2186 2186 HOH HOH A . E 3 HOH 187 2187 2187 HOH HOH A . E 3 HOH 188 2188 2188 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 52.8 ? 2 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A VAL 3 ? A VAL 1488 ? 1_555 73.6 ? 3 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A VAL 3 ? A VAL 1488 ? 1_555 82.3 ? 4 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 138.1 ? 5 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 143.7 ? 6 O ? A VAL 3 ? A VAL 1488 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 73.3 ? 7 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 136.6 ? 8 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 98.6 ? 9 O ? A VAL 3 ? A VAL 1488 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 70.3 ? 10 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 48.1 ? 11 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 76.0 ? 12 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 128.7 ? 13 O ? A VAL 3 ? A VAL 1488 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 84.0 ? 14 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 75.7 ? 15 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 122.4 ? 16 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A THR 20 ? A THR 1505 ? 1_555 70.1 ? 17 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A THR 20 ? A THR 1505 ? 1_555 83.9 ? 18 O ? A VAL 3 ? A VAL 1488 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A THR 20 ? A THR 1505 ? 1_555 142.2 ? 19 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A THR 20 ? A THR 1505 ? 1_555 131.4 ? 20 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A THR 20 ? A THR 1505 ? 1_555 146.8 ? 21 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A THR 20 ? A THR 1505 ? 1_555 77.6 ? 22 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A GLY 22 ? A GLY 1507 ? 1_555 109.5 ? 23 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A GLY 22 ? A GLY 1507 ? 1_555 60.0 ? 24 O ? A VAL 3 ? A VAL 1488 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A GLY 22 ? A GLY 1507 ? 1_555 117.0 ? 25 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A GLY 22 ? A GLY 1507 ? 1_555 108.0 ? 26 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A GLY 22 ? A GLY 1507 ? 1_555 68.3 ? 27 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A GLY 22 ? A GLY 1507 ? 1_555 159.0 ? 28 O ? A THR 20 ? A THR 1505 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A GLY 22 ? A GLY 1507 ? 1_555 85.1 ? 29 OD1 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 136.1 ? 30 OD2 ? A ASP 2 ? A ASP 1487 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 130.4 ? 31 O ? A VAL 3 ? A VAL 1488 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 143.5 ? 32 OE1 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 70.2 ? 33 OE2 ? A GLU 5 ? A GLU 1490 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 86.9 ? 34 OD1 ? A ASN 19 ? A ASN 1504 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 84.8 ? 35 O ? A THR 20 ? A THR 1505 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 67.4 ? 36 O ? A GLY 22 ? A GLY 1507 ? 1_555 SM ? B SM . ? A SM 2648 ? 1_555 O ? A SER 23 ? A SER 1508 ? 1_555 77.4 ? 37 OE2 ? A GLU 99 ? A GLU 1584 ? 1_555 SM ? D SM . ? A SM 2650 ? 1_555 OE1 ? A GLU 99 ? A GLU 1584 ? 1_555 7.2 ? 38 OE2 ? A GLU 99 ? A GLU 1584 ? 1_555 SM ? D SM . ? A SM 2650 ? 1_555 OE2 ? A GLU 99 ? A GLU 1584 ? 1_555 0.0 ? 39 OE1 ? A GLU 99 ? A GLU 1584 ? 1_555 SM ? D SM . ? A SM 2650 ? 1_555 OE2 ? A GLU 99 ? A GLU 1584 ? 1_555 7.2 ? 40 OE2 ? A GLU 99 ? A GLU 1584 ? 1_555 SM ? D SM . ? A SM 2650 ? 1_555 O ? E HOH . ? A HOH 2109 ? 3_656 159.5 ? 41 OE1 ? A GLU 99 ? A GLU 1584 ? 1_555 SM ? D SM . ? A SM 2650 ? 1_555 O ? E HOH . ? A HOH 2109 ? 3_656 153.6 ? 42 OE2 ? A GLU 99 ? A GLU 1584 ? 1_555 SM ? D SM . ? A SM 2650 ? 1_555 O ? E HOH . ? A HOH 2109 ? 3_656 159.5 ? 43 OD1 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OD2 ? A ASP 121 ? A ASP 1606 ? 1_555 52.9 ? 44 OD1 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A ILE 122 ? A ILE 1607 ? 1_555 82.1 ? 45 OD2 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A ILE 122 ? A ILE 1607 ? 1_555 72.2 ? 46 OD1 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OE2 ? A GLU 124 ? A GLU 1609 ? 1_555 129.4 ? 47 OD2 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OE2 ? A GLU 124 ? A GLU 1609 ? 1_555 137.0 ? 48 O ? A ILE 122 ? A ILE 1607 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OE2 ? A GLU 124 ? A GLU 1609 ? 1_555 66.7 ? 49 OD1 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OD1 ? A ASN 139 ? A ASN 1624 ? 1_555 131.9 ? 50 OD2 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OD1 ? A ASN 139 ? A ASN 1624 ? 1_555 79.1 ? 51 O ? A ILE 122 ? A ILE 1607 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OD1 ? A ASN 139 ? A ASN 1624 ? 1_555 83.3 ? 52 OE2 ? A GLU 124 ? A GLU 1609 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 OD1 ? A ASN 139 ? A ASN 1624 ? 1_555 84.3 ? 53 OD1 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A THR 140 ? A THR 1625 ? 1_555 78.9 ? 54 OD2 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A THR 140 ? A THR 1625 ? 1_555 75.5 ? 55 O ? A ILE 122 ? A ILE 1607 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A THR 140 ? A THR 1625 ? 1_555 147.6 ? 56 OE2 ? A GLU 124 ? A GLU 1609 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A THR 140 ? A THR 1625 ? 1_555 144.3 ? 57 OD1 ? A ASN 139 ? A ASN 1624 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A THR 140 ? A THR 1625 ? 1_555 90.1 ? 58 OD1 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A SER 143 ? A SER 1628 ? 1_555 129.4 ? 59 OD2 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A SER 143 ? A SER 1628 ? 1_555 142.0 ? 60 O ? A ILE 122 ? A ILE 1607 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A SER 143 ? A SER 1628 ? 1_555 141.6 ? 61 OE2 ? A GLU 124 ? A GLU 1609 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A SER 143 ? A SER 1628 ? 1_555 75.4 ? 62 OD1 ? A ASN 139 ? A ASN 1624 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A SER 143 ? A SER 1628 ? 1_555 87.3 ? 63 O ? A THR 140 ? A THR 1625 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? A SER 143 ? A SER 1628 ? 1_555 69.2 ? 64 OD1 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? E HOH . ? A HOH 2138 ? 1_555 65.4 ? 65 OD2 ? A ASP 121 ? A ASP 1606 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? E HOH . ? A HOH 2138 ? 1_555 115.6 ? 66 O ? A ILE 122 ? A ILE 1607 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? E HOH . ? A HOH 2138 ? 1_555 84.1 ? 67 OE2 ? A GLU 124 ? A GLU 1609 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? E HOH . ? A HOH 2138 ? 1_555 72.4 ? 68 OD1 ? A ASN 139 ? A ASN 1624 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? E HOH . ? A HOH 2138 ? 1_555 156.4 ? 69 O ? A THR 140 ? A THR 1625 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? E HOH . ? A HOH 2138 ? 1_555 110.9 ? 70 O ? A SER 143 ? A SER 1628 ? 1_555 SM ? C SM . ? A SM 2649 ? 1_555 O ? E HOH . ? A HOH 2138 ? 1_555 90.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-08 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-06-27 5 'Structure model' 1 4 2019-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_conn_angle 2 4 'Structure model' struct_conn 3 5 'Structure model' exptl_crystal_grow # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 2 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 17 4 'Structure model' '_pdbx_struct_conn_angle.value' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 4 'Structure model' '_struct_conn.ptnr2_symmetry' 32 5 'Structure model' '_exptl_crystal_grow.method' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language DENZO 'data reduction' . ? 1 ? ? ? ? SCALEPACK 'data scaling' . ? 2 ? ? ? ? SHARP phasing . ? 3 ? ? ? ? GAP phasing . ? 4 ? ? ? ? CNS refinement 1.1 ? 5 ? ? ? ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CG2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 THR _pdbx_validate_symm_contact.auth_seq_id_1 1495 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CG2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 THR _pdbx_validate_symm_contact.auth_seq_id_2 1495 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_566 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 1497 ? ? 53.10 79.45 2 1 SER A 1508 ? ? -86.91 -114.59 3 1 ASP A 1516 ? ? 83.53 1.19 4 1 ASN A 1551 ? ? 68.44 63.23 5 1 SER A 1565 ? ? -109.05 -137.59 6 1 SER A 1628 ? ? -154.91 -151.31 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2008 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.76 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 1539 ? A ARG 54 2 1 Y 1 A PRO 1540 ? A PRO 55 3 1 Y 1 A ARG 1541 ? A ARG 56 4 1 Y 1 A GLY 1542 ? A GLY 57 5 1 Y 1 A ASP 1543 ? A ASP 58 6 1 Y 1 A ASN 1544 ? A ASN 59 7 1 Y 1 A GLY 1545 ? A GLY 60 8 1 Y 1 A ASP 1546 ? A ASP 61 9 1 Y 1 A THR 1547 ? A THR 62 10 1 Y 1 A ALA 1548 ? A ALA 63 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SAMARIUM (III) ION' SM 3 water HOH #