data_1V38 # _entry.id 1V38 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1V38 pdb_00001v38 10.2210/pdb1v38/pdb RCSB RCSB006150 ? ? WWPDB D_1000006150 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007014005.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1V38 _pdbx_database_status.recvd_initial_deposition_date 2003-10-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goroncy, A.' 1 'Kigawa, T.' 2 'Koshiba, S.' 3 'Kobayashi, N.' 4 'Tochio, N.' 5 'Inoue, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the Sterile Alpha Motif (SAM) domain of mouse SAMSN1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goroncy, A.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Kobayashi, N.' 4 ? primary 'Tochio, N.' 5 ? primary 'Inoue, M.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SAM-domain protein SAMSN-1' _entity.formula_weight 8634.424 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'STERILE ALPHA MOTIF (SAM) DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SAMSN1, SAM domain, SH3 domain and nuclear localisation signals protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLLSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLLSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007014005.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 ARG n 1 10 GLU n 1 11 ASN n 1 12 HIS n 1 13 GLN n 1 14 THR n 1 15 ILE n 1 16 GLN n 1 17 GLU n 1 18 PHE n 1 19 LEU n 1 20 GLU n 1 21 ARG n 1 22 ILE n 1 23 HIS n 1 24 LEU n 1 25 GLN n 1 26 GLU n 1 27 TYR n 1 28 THR n 1 29 SER n 1 30 THR n 1 31 LEU n 1 32 LEU n 1 33 LEU n 1 34 ASN n 1 35 GLY n 1 36 TYR n 1 37 GLU n 1 38 THR n 1 39 LEU n 1 40 ASP n 1 41 ASP n 1 42 LEU n 1 43 LYS n 1 44 ASP n 1 45 ILE n 1 46 LYS n 1 47 GLU n 1 48 SER n 1 49 HIS n 1 50 LEU n 1 51 ILE n 1 52 GLU n 1 53 LEU n 1 54 ASN n 1 55 ILE n 1 56 ALA n 1 57 ASP n 1 58 PRO n 1 59 GLU n 1 60 ASP n 1 61 ARG n 1 62 ALA n 1 63 ARG n 1 64 LEU n 1 65 LEU n 1 66 SER n 1 67 ALA n 1 68 ALA n 1 69 GLU n 1 70 SER n 1 71 LEU n 1 72 LEU n 1 73 SER n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 SER n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030120-80 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAMN1_MOUSE _struct_ref.pdbx_db_accession P57725 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLL _struct_ref.pdbx_align_begin 239 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1V38 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P57725 _struct_ref_seq.db_align_beg 239 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 303 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1V38 GLY A 1 ? UNP P57725 ? ? 'cloning artifact' 1 1 1 1V38 SER A 2 ? UNP P57725 ? ? 'cloning artifact' 2 2 1 1V38 SER A 3 ? UNP P57725 ? ? 'cloning artifact' 3 3 1 1V38 GLY A 4 ? UNP P57725 ? ? 'cloning artifact' 4 4 1 1V38 SER A 5 ? UNP P57725 ? ? 'cloning artifact' 5 5 1 1V38 SER A 6 ? UNP P57725 ? ? 'cloning artifact' 6 6 1 1V38 GLY A 7 ? UNP P57725 ? ? 'cloning artifact' 7 7 1 1V38 SER A 73 ? UNP P57725 ? ? 'cloning artifact' 73 8 1 1V38 GLY A 74 ? UNP P57725 ? ? 'cloning artifact' 74 9 1 1V38 PRO A 75 ? UNP P57725 ? ? 'cloning artifact' 75 10 1 1V38 SER A 76 ? UNP P57725 ? ? 'cloning artifact' 76 11 1 1V38 SER A 77 ? UNP P57725 ? ? 'cloning artifact' 77 12 1 1V38 GLY A 78 ? UNP P57725 ? ? 'cloning artifact' 78 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.19mM SAM domain, 20mM phosphate buffer Na, 100mM NaCl, 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1V38 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1V38 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1V38 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection BRUKER 1 NMRPipe 20020425 processing 'FRANK DELAGLIO' 2 NMRView 5.0.14 'data analysis' 'BRUCE A. JOHNSON' 3 KUJIRA 0.811 'data analysis' 'NAOHIRO KOBAYASHI' 4 CYANA 2.0.15 refinement 'PETER GUENTERT' 5 # _exptl.entry_id 1V38 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1V38 _struct.title 'Solution structure of the Sterile Alpha Motif (SAM) domain of mouse SAMSN1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1V38 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Structural genomics, Hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 14 ? ARG A 21 ? THR A 14 ARG A 21 1 ? 8 HELX_P HELX_P2 2 ILE A 22 ? HIS A 23 ? ILE A 22 HIS A 23 5 ? 2 HELX_P HELX_P3 3 LEU A 24 ? GLU A 26 ? LEU A 24 GLU A 26 5 ? 3 HELX_P HELX_P4 4 TYR A 27 ? GLY A 35 ? TYR A 27 GLY A 35 1 ? 9 HELX_P HELX_P5 5 THR A 38 ? LYS A 43 ? THR A 38 LYS A 43 1 ? 6 HELX_P HELX_P6 6 LYS A 46 ? LEU A 53 ? LYS A 46 LEU A 53 1 ? 8 HELX_P HELX_P7 7 ASP A 57 ? SER A 73 ? ASP A 57 SER A 73 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1V38 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1V38 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-29 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 11 ? ? 43.53 28.86 2 1 THR A 28 ? ? -46.06 -74.31 3 1 TYR A 36 ? ? -63.68 92.52 4 1 LEU A 72 ? ? -68.29 -70.90 5 1 PRO A 75 ? ? -69.79 87.60 6 2 ASN A 11 ? ? -50.77 175.34 7 2 THR A 28 ? ? -38.57 -72.39 8 2 TYR A 36 ? ? -58.70 96.01 9 2 LEU A 71 ? ? -71.97 -70.77 10 2 LEU A 72 ? ? -62.30 -72.50 11 2 SER A 77 ? ? -50.36 176.32 12 3 THR A 28 ? ? -36.99 -71.18 13 3 TYR A 36 ? ? -56.06 93.62 14 3 ALA A 56 ? ? -39.70 -25.34 15 3 SER A 73 ? ? -50.82 87.21 16 3 PRO A 75 ? ? -69.79 89.59 17 4 SER A 5 ? ? -118.22 71.02 18 4 SER A 6 ? ? 35.33 44.45 19 4 HIS A 12 ? ? -35.82 134.62 20 4 THR A 28 ? ? -42.06 -73.24 21 4 TYR A 36 ? ? -64.37 96.40 22 4 LEU A 72 ? ? -59.11 -72.65 23 4 SER A 76 ? ? -52.43 103.92 24 5 THR A 28 ? ? -44.13 -75.11 25 5 TYR A 36 ? ? -55.47 89.62 26 5 SER A 66 ? ? -38.24 -38.01 27 6 THR A 28 ? ? -47.92 -74.58 28 6 TYR A 36 ? ? -56.24 91.39 29 6 LEU A 72 ? ? -59.51 -71.77 30 7 SER A 5 ? ? -67.04 83.30 31 7 THR A 28 ? ? -44.69 -73.59 32 7 TYR A 36 ? ? -62.99 97.62 33 7 LEU A 71 ? ? -64.04 -70.34 34 8 SER A 3 ? ? -55.89 177.86 35 8 SER A 5 ? ? -69.06 95.48 36 8 THR A 28 ? ? -39.63 -74.74 37 8 TYR A 36 ? ? -58.51 101.45 38 8 ALA A 56 ? ? -38.59 -26.00 39 9 SER A 5 ? ? -166.91 107.31 40 9 THR A 28 ? ? -37.79 -73.54 41 9 TYR A 36 ? ? -59.59 91.44 42 9 GLU A 47 ? ? -37.84 -37.61 43 9 ALA A 56 ? ? -38.74 -25.89 44 9 PRO A 75 ? ? -69.71 1.25 45 9 SER A 76 ? ? -37.93 114.72 46 10 SER A 6 ? ? -63.77 90.46 47 10 GLU A 10 ? ? -101.26 41.99 48 10 THR A 28 ? ? -40.47 -73.83 49 10 TYR A 36 ? ? -56.13 96.69 50 10 ALA A 56 ? ? -38.56 -26.09 51 11 THR A 28 ? ? -42.49 -72.29 52 11 TYR A 36 ? ? -55.58 98.35 53 12 ARG A 8 ? ? -95.08 31.74 54 12 ASN A 11 ? ? 35.01 34.53 55 12 GLN A 16 ? ? -34.92 -70.56 56 12 THR A 28 ? ? -45.62 -73.21 57 12 TYR A 36 ? ? -60.48 97.72 58 13 ARG A 8 ? ? 35.23 54.98 59 13 THR A 28 ? ? -38.18 -71.34 60 13 TYR A 36 ? ? -57.70 100.23 61 13 SER A 73 ? ? -91.72 59.18 62 14 SER A 6 ? ? -96.34 41.89 63 14 THR A 28 ? ? -42.59 -73.72 64 14 TYR A 36 ? ? -62.79 94.66 65 14 ASP A 40 ? ? -39.96 -33.59 66 14 SER A 73 ? ? -101.88 48.59 67 15 THR A 28 ? ? -36.33 -72.03 68 15 TYR A 36 ? ? -53.65 91.57 69 15 GLU A 47 ? ? -39.46 -39.72 70 15 ALA A 56 ? ? -37.69 -27.60 71 15 SER A 66 ? ? -39.90 -39.84 72 15 SER A 76 ? ? -42.74 97.96 73 16 GLU A 10 ? ? -35.08 147.29 74 16 THR A 28 ? ? -47.42 -74.59 75 16 TYR A 36 ? ? -57.22 95.80 76 16 ALA A 56 ? ? -38.56 -25.95 77 17 ASN A 11 ? ? -46.64 151.49 78 17 GLN A 16 ? ? -35.53 -71.24 79 17 TYR A 36 ? ? -61.85 97.88 80 17 PRO A 75 ? ? -69.79 2.12 81 18 GLU A 10 ? ? 32.01 54.59 82 18 GLN A 16 ? ? -41.00 -70.17 83 18 THR A 28 ? ? -42.55 -75.10 84 18 TYR A 36 ? ? -57.61 106.82 85 18 SER A 73 ? ? -79.04 47.41 86 19 ASN A 11 ? ? -57.48 -179.69 87 19 THR A 28 ? ? -45.44 -70.51 88 19 ALA A 56 ? ? -38.66 -25.89 89 20 ARG A 8 ? ? -96.58 44.84 90 20 TYR A 36 ? ? -61.46 89.09 91 20 ASP A 40 ? ? -39.45 -33.55 92 20 ALA A 56 ? ? -38.83 -25.75 93 20 SER A 73 ? ? 36.61 47.67 #