data_1VA2 # _entry.id 1VA2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VA2 pdb_00001va2 10.2210/pdb1va2/pdb RCSB RCSB006395 ? ? WWPDB D_1000006395 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_site 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VA2 _pdbx_database_status.recvd_initial_deposition_date 2004-02-07 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1VA1 'The same protein, Zinc Finger 1 domain' unspecified PDB 1VA3 'The same protein, Zinc Finger 3 domain' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Oka, S.' 1 'Shiraishi, Y.' 2 'Yoshida, T.' 3 'Ohkubo, T.' 4 'Sugiura, Y.' 5 'Kobayashi, Y.' 6 # _citation.id primary _citation.title 'NMR structure of transcription factor Sp1 DNA binding domain' _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 16027 _citation.page_last 16035 _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15609997 _citation.pdbx_database_id_DOI 10.1021/bi048438p # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Oka, S.' 1 ? primary 'Shiraishi, Y.' 2 ? primary 'Yoshida, T.' 3 ? primary 'Ohkubo, T.' 4 ? primary 'Sugiura, Y.' 5 ? primary 'Kobayashi, Y.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcription factor Sp1' 3853.421 1 ? ? 'Zinc finger 2' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RPFMCTWSYCGKRFTRSDELQRHKRTHTGEK _entity_poly.pdbx_seq_one_letter_code_can RPFMCTWSYCGKRFTRSDELQRHKRTHTGEK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 PRO n 1 3 PHE n 1 4 MET n 1 5 CYS n 1 6 THR n 1 7 TRP n 1 8 SER n 1 9 TYR n 1 10 CYS n 1 11 GLY n 1 12 LYS n 1 13 ARG n 1 14 PHE n 1 15 THR n 1 16 ARG n 1 17 SER n 1 18 ASP n 1 19 GLU n 1 20 LEU n 1 21 GLN n 1 22 ARG n 1 23 HIS n 1 24 LYS n 1 25 ARG n 1 26 THR n 1 27 HIS n 1 28 THR n 1 29 GLY n 1 30 GLU n 1 31 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pEVSp1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 565 565 ARG ARG A . n A 1 2 PRO 2 566 566 PRO PRO A . n A 1 3 PHE 3 567 567 PHE PHE A . n A 1 4 MET 4 568 568 MET MET A . n A 1 5 CYS 5 569 569 CYS CYS A . n A 1 6 THR 6 570 570 THR THR A . n A 1 7 TRP 7 571 571 TRP TRP A . n A 1 8 SER 8 572 572 SER SER A . n A 1 9 TYR 9 573 573 TYR TYR A . n A 1 10 CYS 10 574 574 CYS CYS A . n A 1 11 GLY 11 575 575 GLY GLY A . n A 1 12 LYS 12 576 576 LYS LYS A . n A 1 13 ARG 13 577 577 ARG ARG A . n A 1 14 PHE 14 578 578 PHE PHE A . n A 1 15 THR 15 579 579 THR THR A . n A 1 16 ARG 16 580 580 ARG ARG A . n A 1 17 SER 17 581 581 SER SER A . n A 1 18 ASP 18 582 582 ASP ASP A . n A 1 19 GLU 19 583 583 GLU GLU A . n A 1 20 LEU 20 584 584 LEU LEU A . n A 1 21 GLN 21 585 585 GLN GLN A . n A 1 22 ARG 22 586 586 ARG ARG A . n A 1 23 HIS 23 587 587 HIS HIS A . n A 1 24 LYS 24 588 588 LYS LYS A . n A 1 25 ARG 25 589 589 ARG ARG A . n A 1 26 THR 26 590 590 THR THR A . n A 1 27 HIS 27 591 591 HIS HIS A . n A 1 28 THR 28 592 592 THR THR A . n A 1 29 GLY 29 593 593 GLY GLY A . n A 1 30 GLU 30 594 594 GLU GLU A . n A 1 31 LYS 31 595 595 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 100 _pdbx_nonpoly_scheme.auth_seq_num 100 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1VA2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1VA2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1VA2 _struct.title 'Solution Structure of Transcription Factor Sp1 DNA Binding Domain (Zinc Finger 2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1VA2 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'C2H2 type Zinc finger, Transcription Factor, DNA-Binding Protein, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SP1_HUMAN _struct_ref.pdbx_db_accession P08047 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RPFMCTWSYCGKRFTRSDELQRHKRTHTGEK _struct_ref.pdbx_align_begin 654 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VA2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08047 _struct_ref_seq.db_align_beg 654 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 684 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 565 _struct_ref_seq.pdbx_auth_seq_align_end 595 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 16 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 580 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 589 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 5 SG ? ? A ZN 100 A CYS 569 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 10 SG ? ? A ZN 100 A CYS 574 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 23 NE2 ? ? A ZN 100 A HIS 587 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 27 NE2 ? ? A ZN 100 A HIS 591 1_555 ? ? ? ? ? ? ? 2.017 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 5 ? A CYS 569 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 SG ? A CYS 10 ? A CYS 574 ? 1_555 91.5 ? 2 SG ? A CYS 5 ? A CYS 569 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 23 ? A HIS 587 ? 1_555 128.8 ? 3 SG ? A CYS 10 ? A CYS 574 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 23 ? A HIS 587 ? 1_555 125.9 ? 4 SG ? A CYS 5 ? A CYS 569 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 27 ? A HIS 591 ? 1_555 124.9 ? 5 SG ? A CYS 10 ? A CYS 574 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 27 ? A HIS 591 ? 1_555 86.6 ? 6 NE2 ? A HIS 23 ? A HIS 587 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 27 ? A HIS 591 ? 1_555 94.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 3 ? MET A 4 ? PHE A 567 MET A 568 A 2 ARG A 13 ? PHE A 14 ? ARG A 577 PHE A 578 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 3 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 567 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 14 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 578 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 100 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 100' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 5 ? CYS A 569 . ? 1_555 ? 2 AC1 4 CYS A 10 ? CYS A 574 . ? 1_555 ? 3 AC1 4 HIS A 23 ? HIS A 587 . ? 1_555 ? 4 AC1 4 HIS A 27 ? HIS A 591 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 583 ? ? H A HIS 587 ? ? 1.54 2 2 O A GLU 583 ? ? H A HIS 587 ? ? 1.52 3 3 O A GLU 583 ? ? H A HIS 587 ? ? 1.51 4 4 O A GLU 583 ? ? H A HIS 587 ? ? 1.57 5 5 O A GLU 583 ? ? H A HIS 587 ? ? 1.56 6 6 O A GLU 583 ? ? H A HIS 587 ? ? 1.54 7 7 O A GLU 583 ? ? H A HIS 587 ? ? 1.55 8 8 O A GLU 583 ? ? H A HIS 587 ? ? 1.51 9 9 O A GLU 583 ? ? H A HIS 587 ? ? 1.52 10 10 O A GLU 583 ? ? H A HIS 587 ? ? 1.49 11 11 O A GLU 583 ? ? H A HIS 587 ? ? 1.52 12 12 O A GLU 583 ? ? H A HIS 587 ? ? 1.53 13 13 O A GLU 583 ? ? H A HIS 587 ? ? 1.46 14 15 O A GLU 583 ? ? H A HIS 587 ? ? 1.54 15 16 O A GLU 583 ? ? H A HIS 587 ? ? 1.52 16 17 O A GLU 583 ? ? H A HIS 587 ? ? 1.58 17 18 O A GLU 583 ? ? H A HIS 587 ? ? 1.47 18 19 O A GLU 583 ? ? H A HIS 587 ? ? 1.52 19 20 O A GLU 583 ? ? H A HIS 587 ? ? 1.46 20 21 O A GLU 583 ? ? H A HIS 587 ? ? 1.50 21 22 O A GLU 583 ? ? H A HIS 587 ? ? 1.48 22 23 O A GLU 583 ? ? H A HIS 587 ? ? 1.51 23 24 O A GLU 583 ? ? H A HIS 587 ? ? 1.52 24 25 O A GLU 583 ? ? H A HIS 587 ? ? 1.42 25 26 O A GLU 583 ? ? H A HIS 587 ? ? 1.47 26 27 O A GLU 583 ? ? H A HIS 587 ? ? 1.54 27 28 O A GLU 583 ? ? H A HIS 587 ? ? 1.52 28 29 O A GLU 583 ? ? H A HIS 587 ? ? 1.49 29 30 O A GLU 583 ? ? H A HIS 587 ? ? 1.45 30 31 O A GLU 583 ? ? H A HIS 587 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 566 ? ? -83.22 46.91 2 1 TRP A 571 ? ? -56.39 103.83 3 1 GLU A 594 ? ? -163.35 -44.68 4 2 GLU A 594 ? ? 62.29 -80.25 5 3 TRP A 571 ? ? -63.86 98.02 6 3 GLU A 594 ? ? 57.23 97.02 7 4 PRO A 566 ? ? -81.66 49.73 8 4 GLU A 594 ? ? -91.58 -66.26 9 5 PRO A 566 ? ? -83.84 47.16 10 5 TRP A 571 ? ? 39.45 -162.74 11 5 TYR A 573 ? ? -172.84 38.35 12 6 HIS A 591 ? ? -95.77 -66.99 13 7 PRO A 566 ? ? -84.22 47.30 14 7 TRP A 571 ? ? 40.94 -163.15 15 7 TYR A 573 ? ? -172.33 38.78 16 7 THR A 592 ? ? 58.62 107.98 17 8 CYS A 569 ? ? -56.83 -170.45 18 8 TRP A 571 ? ? -51.08 177.82 19 9 PRO A 566 ? ? -81.70 47.63 20 9 TRP A 571 ? ? -52.45 176.53 21 9 TYR A 573 ? ? -167.42 83.51 22 9 THR A 592 ? ? 53.38 98.51 23 9 GLU A 594 ? ? -62.50 -74.82 24 10 TRP A 571 ? ? -49.25 172.69 25 11 PRO A 566 ? ? -82.60 47.61 26 11 TRP A 571 ? ? -48.31 171.57 27 11 TYR A 573 ? ? -164.38 82.01 28 12 PRO A 566 ? ? -83.53 43.89 29 12 TRP A 571 ? ? 39.94 -163.79 30 12 TYR A 573 ? ? -171.64 35.04 31 13 PRO A 566 ? ? -84.34 47.78 32 13 THR A 570 ? ? -94.46 37.02 33 13 TYR A 573 ? ? -162.47 75.39 34 13 GLU A 594 ? ? 60.87 73.73 35 14 TRP A 571 ? ? 40.66 -163.83 36 14 TYR A 573 ? ? -171.71 42.81 37 14 THR A 592 ? ? 45.41 -167.72 38 15 TRP A 571 ? ? -52.25 -179.75 39 15 TYR A 573 ? ? -163.76 79.55 40 16 PRO A 566 ? ? -68.77 63.78 41 16 LYS A 576 ? ? -160.88 117.72 42 17 TRP A 571 ? ? -54.05 -176.30 43 17 TYR A 573 ? ? -158.70 76.03 44 17 GLU A 594 ? ? 60.45 85.11 45 18 PRO A 566 ? ? -66.90 58.27 46 18 TRP A 571 ? ? -47.44 168.91 47 18 TYR A 573 ? ? -161.51 82.72 48 18 THR A 592 ? ? 43.35 91.49 49 19 PRO A 566 ? ? -69.22 60.98 50 19 TRP A 571 ? ? -46.24 167.30 51 19 TYR A 573 ? ? -163.34 87.34 52 20 PRO A 566 ? ? -83.42 47.93 53 20 THR A 570 ? ? -92.90 37.85 54 20 TYR A 573 ? ? -161.14 73.00 55 20 THR A 592 ? ? -159.35 -45.60 56 21 PRO A 566 ? ? -81.71 49.33 57 21 TYR A 573 ? ? -163.90 86.32 58 22 TRP A 571 ? ? -50.23 171.64 59 22 TYR A 573 ? ? -165.34 84.19 60 23 THR A 570 ? ? -92.83 33.92 61 23 TRP A 571 ? ? -67.22 -177.43 62 23 TYR A 573 ? ? -158.20 77.64 63 24 THR A 592 ? ? 52.88 -170.13 64 25 PRO A 566 ? ? -83.02 47.36 65 25 THR A 570 ? ? -93.77 34.90 66 25 TYR A 573 ? ? -161.94 75.35 67 25 GLU A 594 ? ? 61.52 165.84 68 26 PRO A 566 ? ? -66.15 80.64 69 26 THR A 570 ? ? -94.56 35.93 70 26 TYR A 573 ? ? -166.64 76.05 71 27 THR A 570 ? ? -84.58 36.21 72 27 TRP A 571 ? ? -68.16 -177.30 73 27 TYR A 573 ? ? -163.62 72.08 74 27 HIS A 591 ? ? -162.53 103.02 75 28 PRO A 566 ? ? -81.20 48.00 76 28 TRP A 571 ? ? -44.75 -98.97 77 28 TYR A 573 ? ? -154.81 52.89 78 28 LYS A 576 ? ? -169.39 114.16 79 29 PRO A 566 ? ? -83.70 49.70 80 29 TRP A 571 ? ? -54.03 -99.86 81 29 TYR A 573 ? ? -179.20 79.83 82 29 GLU A 594 ? ? 60.94 156.49 83 30 PRO A 566 ? ? -82.05 47.86 84 30 THR A 570 ? ? -85.18 39.46 85 30 TYR A 573 ? ? -157.23 52.47 86 30 HIS A 591 ? ? -172.23 28.10 87 30 GLU A 594 ? ? -147.40 31.63 88 31 PRO A 566 ? ? -84.87 45.87 89 31 TRP A 571 ? ? -40.15 -86.53 90 31 TYR A 573 ? ? -163.88 60.47 91 31 HIS A 591 ? ? -105.34 -71.26 92 31 GLU A 594 ? ? -154.38 74.34 # _pdbx_nmr_ensemble.entry_id 1VA2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 31 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1VA2 _pdbx_nmr_representative.conformer_id 31 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM Sp1 DNA-Binding Domain U-15N/13C; 10mM Tris-d; 50mM NaCl; 1mM DTT' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10mM Tris-d, 50mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1VA2 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1VA2 _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.1 'structure solution' ? 1 NMRPipe 2.1 processing 'F. Delaglio, et al.' 2 NMRView 5.0.4 'data analysis' 'Bruce A. Johnson' 3 CNS 1.1 refinement ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASP N N N N 28 ASP CA C N S 29 ASP C C N N 30 ASP O O N N 31 ASP CB C N N 32 ASP CG C N N 33 ASP OD1 O N N 34 ASP OD2 O N N 35 ASP OXT O N N 36 ASP H H N N 37 ASP H2 H N N 38 ASP HA H N N 39 ASP HB2 H N N 40 ASP HB3 H N N 41 ASP HD2 H N N 42 ASP HXT H N N 43 CYS N N N N 44 CYS CA C N R 45 CYS C C N N 46 CYS O O N N 47 CYS CB C N N 48 CYS SG S N N 49 CYS OXT O N N 50 CYS H H N N 51 CYS H2 H N N 52 CYS HA H N N 53 CYS HB2 H N N 54 CYS HB3 H N N 55 CYS HG H N N 56 CYS HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 PRO N N N N 218 PRO CA C N S 219 PRO C C N N 220 PRO O O N N 221 PRO CB C N N 222 PRO CG C N N 223 PRO CD C N N 224 PRO OXT O N N 225 PRO H H N N 226 PRO HA H N N 227 PRO HB2 H N N 228 PRO HB3 H N N 229 PRO HG2 H N N 230 PRO HG3 H N N 231 PRO HD2 H N N 232 PRO HD3 H N N 233 PRO HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TRP N N N N 266 TRP CA C N S 267 TRP C C N N 268 TRP O O N N 269 TRP CB C N N 270 TRP CG C Y N 271 TRP CD1 C Y N 272 TRP CD2 C Y N 273 TRP NE1 N Y N 274 TRP CE2 C Y N 275 TRP CE3 C Y N 276 TRP CZ2 C Y N 277 TRP CZ3 C Y N 278 TRP CH2 C Y N 279 TRP OXT O N N 280 TRP H H N N 281 TRP H2 H N N 282 TRP HA H N N 283 TRP HB2 H N N 284 TRP HB3 H N N 285 TRP HD1 H N N 286 TRP HE1 H N N 287 TRP HE3 H N N 288 TRP HZ2 H N N 289 TRP HZ3 H N N 290 TRP HH2 H N N 291 TRP HXT H N N 292 TYR N N N N 293 TYR CA C N S 294 TYR C C N N 295 TYR O O N N 296 TYR CB C N N 297 TYR CG C Y N 298 TYR CD1 C Y N 299 TYR CD2 C Y N 300 TYR CE1 C Y N 301 TYR CE2 C Y N 302 TYR CZ C Y N 303 TYR OH O N N 304 TYR OXT O N N 305 TYR H H N N 306 TYR H2 H N N 307 TYR HA H N N 308 TYR HB2 H N N 309 TYR HB3 H N N 310 TYR HD1 H N N 311 TYR HD2 H N N 312 TYR HE1 H N N 313 TYR HE2 H N N 314 TYR HH H N N 315 TYR HXT H N N 316 ZN ZN ZN N N 317 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASP N CA sing N N 27 ASP N H sing N N 28 ASP N H2 sing N N 29 ASP CA C sing N N 30 ASP CA CB sing N N 31 ASP CA HA sing N N 32 ASP C O doub N N 33 ASP C OXT sing N N 34 ASP CB CG sing N N 35 ASP CB HB2 sing N N 36 ASP CB HB3 sing N N 37 ASP CG OD1 doub N N 38 ASP CG OD2 sing N N 39 ASP OD2 HD2 sing N N 40 ASP OXT HXT sing N N 41 CYS N CA sing N N 42 CYS N H sing N N 43 CYS N H2 sing N N 44 CYS CA C sing N N 45 CYS CA CB sing N N 46 CYS CA HA sing N N 47 CYS C O doub N N 48 CYS C OXT sing N N 49 CYS CB SG sing N N 50 CYS CB HB2 sing N N 51 CYS CB HB3 sing N N 52 CYS SG HG sing N N 53 CYS OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 LEU N CA sing N N 122 LEU N H sing N N 123 LEU N H2 sing N N 124 LEU CA C sing N N 125 LEU CA CB sing N N 126 LEU CA HA sing N N 127 LEU C O doub N N 128 LEU C OXT sing N N 129 LEU CB CG sing N N 130 LEU CB HB2 sing N N 131 LEU CB HB3 sing N N 132 LEU CG CD1 sing N N 133 LEU CG CD2 sing N N 134 LEU CG HG sing N N 135 LEU CD1 HD11 sing N N 136 LEU CD1 HD12 sing N N 137 LEU CD1 HD13 sing N N 138 LEU CD2 HD21 sing N N 139 LEU CD2 HD22 sing N N 140 LEU CD2 HD23 sing N N 141 LEU OXT HXT sing N N 142 LYS N CA sing N N 143 LYS N H sing N N 144 LYS N H2 sing N N 145 LYS CA C sing N N 146 LYS CA CB sing N N 147 LYS CA HA sing N N 148 LYS C O doub N N 149 LYS C OXT sing N N 150 LYS CB CG sing N N 151 LYS CB HB2 sing N N 152 LYS CB HB3 sing N N 153 LYS CG CD sing N N 154 LYS CG HG2 sing N N 155 LYS CG HG3 sing N N 156 LYS CD CE sing N N 157 LYS CD HD2 sing N N 158 LYS CD HD3 sing N N 159 LYS CE NZ sing N N 160 LYS CE HE2 sing N N 161 LYS CE HE3 sing N N 162 LYS NZ HZ1 sing N N 163 LYS NZ HZ2 sing N N 164 LYS NZ HZ3 sing N N 165 LYS OXT HXT sing N N 166 MET N CA sing N N 167 MET N H sing N N 168 MET N H2 sing N N 169 MET CA C sing N N 170 MET CA CB sing N N 171 MET CA HA sing N N 172 MET C O doub N N 173 MET C OXT sing N N 174 MET CB CG sing N N 175 MET CB HB2 sing N N 176 MET CB HB3 sing N N 177 MET CG SD sing N N 178 MET CG HG2 sing N N 179 MET CG HG3 sing N N 180 MET SD CE sing N N 181 MET CE HE1 sing N N 182 MET CE HE2 sing N N 183 MET CE HE3 sing N N 184 MET OXT HXT sing N N 185 PHE N CA sing N N 186 PHE N H sing N N 187 PHE N H2 sing N N 188 PHE CA C sing N N 189 PHE CA CB sing N N 190 PHE CA HA sing N N 191 PHE C O doub N N 192 PHE C OXT sing N N 193 PHE CB CG sing N N 194 PHE CB HB2 sing N N 195 PHE CB HB3 sing N N 196 PHE CG CD1 doub Y N 197 PHE CG CD2 sing Y N 198 PHE CD1 CE1 sing Y N 199 PHE CD1 HD1 sing N N 200 PHE CD2 CE2 doub Y N 201 PHE CD2 HD2 sing N N 202 PHE CE1 CZ doub Y N 203 PHE CE1 HE1 sing N N 204 PHE CE2 CZ sing Y N 205 PHE CE2 HE2 sing N N 206 PHE CZ HZ sing N N 207 PHE OXT HXT sing N N 208 PRO N CA sing N N 209 PRO N CD sing N N 210 PRO N H sing N N 211 PRO CA C sing N N 212 PRO CA CB sing N N 213 PRO CA HA sing N N 214 PRO C O doub N N 215 PRO C OXT sing N N 216 PRO CB CG sing N N 217 PRO CB HB2 sing N N 218 PRO CB HB3 sing N N 219 PRO CG CD sing N N 220 PRO CG HG2 sing N N 221 PRO CG HG3 sing N N 222 PRO CD HD2 sing N N 223 PRO CD HD3 sing N N 224 PRO OXT HXT sing N N 225 SER N CA sing N N 226 SER N H sing N N 227 SER N H2 sing N N 228 SER CA C sing N N 229 SER CA CB sing N N 230 SER CA HA sing N N 231 SER C O doub N N 232 SER C OXT sing N N 233 SER CB OG sing N N 234 SER CB HB2 sing N N 235 SER CB HB3 sing N N 236 SER OG HG sing N N 237 SER OXT HXT sing N N 238 THR N CA sing N N 239 THR N H sing N N 240 THR N H2 sing N N 241 THR CA C sing N N 242 THR CA CB sing N N 243 THR CA HA sing N N 244 THR C O doub N N 245 THR C OXT sing N N 246 THR CB OG1 sing N N 247 THR CB CG2 sing N N 248 THR CB HB sing N N 249 THR OG1 HG1 sing N N 250 THR CG2 HG21 sing N N 251 THR CG2 HG22 sing N N 252 THR CG2 HG23 sing N N 253 THR OXT HXT sing N N 254 TRP N CA sing N N 255 TRP N H sing N N 256 TRP N H2 sing N N 257 TRP CA C sing N N 258 TRP CA CB sing N N 259 TRP CA HA sing N N 260 TRP C O doub N N 261 TRP C OXT sing N N 262 TRP CB CG sing N N 263 TRP CB HB2 sing N N 264 TRP CB HB3 sing N N 265 TRP CG CD1 doub Y N 266 TRP CG CD2 sing Y N 267 TRP CD1 NE1 sing Y N 268 TRP CD1 HD1 sing N N 269 TRP CD2 CE2 doub Y N 270 TRP CD2 CE3 sing Y N 271 TRP NE1 CE2 sing Y N 272 TRP NE1 HE1 sing N N 273 TRP CE2 CZ2 sing Y N 274 TRP CE3 CZ3 doub Y N 275 TRP CE3 HE3 sing N N 276 TRP CZ2 CH2 doub Y N 277 TRP CZ2 HZ2 sing N N 278 TRP CZ3 CH2 sing Y N 279 TRP CZ3 HZ3 sing N N 280 TRP CH2 HH2 sing N N 281 TRP OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1VA2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_