data_1VBV # _entry.id 1VBV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.292 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1VBV RCSB RCSB006442 WWPDB D_1000006442 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2018-04-11 _pdbx_database_PDB_obs_spr.pdb_id 5YCQ _pdbx_database_PDB_obs_spr.replace_pdb_id 1VBV _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 1VBV _pdbx_database_status.recvd_initial_deposition_date 2004-03-02 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shioi, S.' 1 'Maenaka, K.' 2 'Kohda, D.' 3 'Katayama, T.' 4 'Ueda, T.' 5 # _citation.id primary _citation.title 'Crystal structure of hypothetical protein from Esherichia coli' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Shioi, S.' 1 primary 'Maenaka, K.' 2 primary 'Kohda, D.' 3 primary 'Katayama, T.' 4 primary 'Abe, Y.' 5 primary 'Ueda, T.' 6 # _cell.entry_id 1VBV _cell.length_a 76.822 _cell.length_b 76.822 _cell.length_c 85.888 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VBV _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein b0966' 11790.145 1 ? ? ? ? 2 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'protein degradation factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDNGLPVHTYLAEAQLSSELQDE HPEQPSMDELAQTIRKQLQAPRLRN ; _entity_poly.pdbx_seq_one_letter_code_can ;MIASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDNGLPVHTYLAEAQLSSELQDE HPEQPSMDELAQTIRKQLQAPRLRN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 ALA n 1 4 SER n 1 5 LYS n 1 6 PHE n 1 7 GLY n 1 8 ILE n 1 9 GLY n 1 10 GLN n 1 11 GLN n 1 12 VAL n 1 13 ARG n 1 14 HIS n 1 15 SER n 1 16 LEU n 1 17 LEU n 1 18 GLY n 1 19 TYR n 1 20 LEU n 1 21 GLY n 1 22 VAL n 1 23 VAL n 1 24 VAL n 1 25 ASP n 1 26 ILE n 1 27 ASP n 1 28 PRO n 1 29 VAL n 1 30 TYR n 1 31 SER n 1 32 LEU n 1 33 SER n 1 34 GLU n 1 35 PRO n 1 36 SER n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 LEU n 1 41 ALA n 1 42 VAL n 1 43 ASN n 1 44 ASP n 1 45 GLU n 1 46 LEU n 1 47 ARG n 1 48 ALA n 1 49 ALA n 1 50 PRO n 1 51 TRP n 1 52 TYR n 1 53 HIS n 1 54 VAL n 1 55 VAL n 1 56 MET n 1 57 GLU n 1 58 ASP n 1 59 ASP n 1 60 ASN n 1 61 GLY n 1 62 LEU n 1 63 PRO n 1 64 VAL n 1 65 HIS n 1 66 THR n 1 67 TYR n 1 68 LEU n 1 69 ALA n 1 70 GLU n 1 71 ALA n 1 72 GLN n 1 73 LEU n 1 74 SER n 1 75 SER n 1 76 GLU n 1 77 LEU n 1 78 GLN n 1 79 ASP n 1 80 GLU n 1 81 HIS n 1 82 PRO n 1 83 GLU n 1 84 GLN n 1 85 PRO n 1 86 SER n 1 87 MET n 1 88 ASP n 1 89 GLU n 1 90 LEU n 1 91 ALA n 1 92 GLN n 1 93 THR n 1 94 ILE n 1 95 ARG n 1 96 LYS n 1 97 GLN n 1 98 LEU n 1 99 GLN n 1 100 ALA n 1 101 PRO n 1 102 ARG n 1 103 LEU n 1 104 ARG n 1 105 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'K12, MG1655, W3110' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YCCV_ECOLI _struct_ref.pdbx_db_accession P0AB20 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDNGLPVHTYLAEAQLSSELQDE HPEQPSMDELAQTIRKQLQAPRLRN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VBV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AB20 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1VBV _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.07 _exptl_crystal.density_percent_sol 40.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details 'Ammonium Sulfate, HEPES, pH 7.0, VAPOR DIFFUSION, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2003-11-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9792 1.0 2 0.9794 1.0 3 0.9851 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL40B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL40B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9792, 0.9794, 0.9851' # _reflns.entry_id 1VBV _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.5 _reflns.number_obs 3506 _reflns.number_all 3506 _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 17.5 _reflns.B_iso_Wilson_estimate 46.9 _reflns.pdbx_redundancy 21.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.301 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 19.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 340 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1VBV _refine.ls_number_reflns_obs 2763 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 3488432.99 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.21 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 98.4 _refine.ls_R_factor_obs 0.228 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.228 _refine.ls_R_factor_R_free 0.295 _refine.ls_R_factor_R_free_error 0.024 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 145 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 51.0 _refine.aniso_B[1][1] -21.31 _refine.aniso_B[2][2] -21.31 _refine.aniso_B[3][3] 42.63 _refine.aniso_B[1][2] -8.28 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.346471 _refine.solvent_model_param_bsol 43.8773 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1VBV _refine_analyze.Luzzati_coordinate_error_obs 0.33 _refine_analyze.Luzzati_sigma_a_obs 0.38 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.42 _refine_analyze.Luzzati_sigma_a_free 0.36 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 603 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 607 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 19.21 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.6 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.3 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.90 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.67 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.98 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.18 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.32 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.82 _refine_ls_shell.number_reflns_R_work 413 _refine_ls_shell.R_factor_R_work 0.291 _refine_ls_shell.percent_reflns_obs 96.5 _refine_ls_shell.R_factor_R_free 0.35 _refine_ls_shell.R_factor_R_free_error 0.066 _refine_ls_shell.percent_reflns_R_free 6.3 _refine_ls_shell.number_reflns_R_free 28 _refine_ls_shell.number_reflns_obs 322 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ? 'X-RAY DIFFRACTION' # _struct.entry_id 1VBV _struct.title 'Crystal structure of hypothetical protein from Esherichia coli' _struct.pdbx_descriptor 'protein degradation factor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VBV _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'protein degradation, structural genomics, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 84 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 95 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 84 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 95 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 49 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 49 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 50 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 50 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.22 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PRO A 63 ? ALA A 69 ? PRO A 63 ALA A 69 A 2 TRP A 51 ? GLU A 57 ? TRP A 51 GLU A 57 A 3 LEU A 20 ? ASP A 27 ? LEU A 20 ASP A 27 A 4 GLN A 11 ? HIS A 14 ? GLN A 11 HIS A 14 A 5 LEU A 73 ? SER A 75 ? LEU A 73 SER A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 64 ? O VAL A 64 N MET A 56 ? N MET A 56 A 2 3 O TRP A 51 ? O TRP A 51 N ASP A 27 ? N ASP A 27 A 3 4 O GLY A 21 ? O GLY A 21 N VAL A 12 ? N VAL A 12 A 4 5 N ARG A 13 ? N ARG A 13 O SER A 74 ? O SER A 74 # _database_PDB_matrix.entry_id 1VBV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1VBV _atom_sites.fract_transf_matrix[1][1] 0.013017 _atom_sites.fract_transf_matrix[1][2] 0.007515 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015031 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011643 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 ? ? ? A . n A 1 31 SER 31 31 ? ? ? A . n A 1 32 LEU 32 32 ? ? ? A . n A 1 33 SER 33 33 ? ? ? A . n A 1 34 GLU 34 34 ? ? ? A . n A 1 35 PRO 35 35 ? ? ? A . n A 1 36 SER 36 36 ? ? ? A . n A 1 37 PRO 37 37 ? ? ? A . n A 1 38 ASP 38 38 ? ? ? A . n A 1 39 GLU 39 39 ? ? ? A . n A 1 40 LEU 40 40 ? ? ? A . n A 1 41 ALA 41 41 ? ? ? A . n A 1 42 VAL 42 42 ? ? ? A . n A 1 43 ASN 43 43 ? ? ? A . n A 1 44 ASP 44 44 ? ? ? A . n A 1 45 GLU 45 45 ? ? ? A . n A 1 46 LEU 46 46 ? ? ? A . n A 1 47 ARG 47 47 ? ? ? A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LEU 98 98 ? ? ? A . n A 1 99 GLN 99 99 ? ? ? A . n A 1 100 ALA 100 100 ? ? ? A . n A 1 101 PRO 101 101 ? ? ? A . n A 1 102 ARG 102 102 ? ? ? A . n A 1 103 LEU 103 103 ? ? ? A . n A 1 104 ARG 104 104 ? ? ? A . n A 1 105 ASN 105 105 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 106 1 HOH TIP A . B 2 HOH 2 107 2 HOH TIP A . B 2 HOH 3 108 3 HOH TIP A . B 2 HOH 4 109 4 HOH TIP A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2,3 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 3330 ? 2 MORE -26 ? 2 'SSA (A^2)' 11210 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 76.8220000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 38.4110000000 -0.8660254038 -0.5000000000 0.0000000000 66.5298035695 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-10-04 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-04-11 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 4 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Data collection' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_PDB_obs_spr 2 4 'Structure model' pdbx_database_status # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.status_code' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 SOLVE phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 49 ? ? -26.03 -94.74 2 1 LEU A 77 ? ? -62.63 -73.99 3 1 GLN A 84 ? ? -143.05 55.58 4 1 ARG A 95 ? ? -62.98 18.44 5 1 LYS A 96 ? ? -145.34 -31.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A TYR 30 ? A TYR 30 4 1 Y 1 A SER 31 ? A SER 31 5 1 Y 1 A LEU 32 ? A LEU 32 6 1 Y 1 A SER 33 ? A SER 33 7 1 Y 1 A GLU 34 ? A GLU 34 8 1 Y 1 A PRO 35 ? A PRO 35 9 1 Y 1 A SER 36 ? A SER 36 10 1 Y 1 A PRO 37 ? A PRO 37 11 1 Y 1 A ASP 38 ? A ASP 38 12 1 Y 1 A GLU 39 ? A GLU 39 13 1 Y 1 A LEU 40 ? A LEU 40 14 1 Y 1 A ALA 41 ? A ALA 41 15 1 Y 1 A VAL 42 ? A VAL 42 16 1 Y 1 A ASN 43 ? A ASN 43 17 1 Y 1 A ASP 44 ? A ASP 44 18 1 Y 1 A GLU 45 ? A GLU 45 19 1 Y 1 A LEU 46 ? A LEU 46 20 1 Y 1 A ARG 47 ? A ARG 47 21 1 Y 1 A LEU 98 ? A LEU 98 22 1 Y 1 A GLN 99 ? A GLN 99 23 1 Y 1 A ALA 100 ? A ALA 100 24 1 Y 1 A PRO 101 ? A PRO 101 25 1 Y 1 A ARG 102 ? A ARG 102 26 1 Y 1 A LEU 103 ? A LEU 103 27 1 Y 1 A ARG 104 ? A ARG 104 28 1 Y 1 A ASN 105 ? A ASN 105 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #