data_1VDI # _entry.id 1VDI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VDI pdb_00001vdi 10.2210/pdb1vdi/pdb RCSB RCSB006493 ? ? WWPDB D_1000006493 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-09-06 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VDI _pdbx_database_status.recvd_initial_deposition_date 2004-03-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1VDJ _pdbx_database_related.details 'the same protein in Ca2+-bound state' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Murakami, K.' 1 'Yumoto, F.' 2 'Ohki, S.' 3 'Yasunaga, T.' 4 'Tanokura, M.' 5 'Wakabayashi, T.' 6 # _citation.id primary _citation.title 'Structural Basis for Ca(2+)-regulated Muscle Relaxation at Interaction Sites of Troponin with Actin and Tropomyosin' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 352 _citation.page_first 178 _citation.page_last 201 _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16061251 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2005.06.067 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Murakami, K.' 1 ? primary 'Yumoto, F.' 2 ? primary 'Ohki, S.' 3 ? primary 'Yasunaga, T.' 4 ? primary 'Tanokura, M.' 5 ? primary 'Wakabayashi, T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Troponin I, fast skeletal muscle' _entity.formula_weight 6139.989 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 131-182' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Troponin I, fast-twitch isoform' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KVNMDLRANLKQVKKEDTEKEKDLRDVGDWRKNIEEKSGMEGRKKMFEAGES _entity_poly.pdbx_seq_one_letter_code_can KVNMDLRANLKQVKKEDTEKEKDLRDVGDWRKNIEEKSGMEGRKKMFEAGES _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 VAL n 1 3 ASN n 1 4 MET n 1 5 ASP n 1 6 LEU n 1 7 ARG n 1 8 ALA n 1 9 ASN n 1 10 LEU n 1 11 LYS n 1 12 GLN n 1 13 VAL n 1 14 LYS n 1 15 LYS n 1 16 GLU n 1 17 ASP n 1 18 THR n 1 19 GLU n 1 20 LYS n 1 21 GLU n 1 22 LYS n 1 23 ASP n 1 24 LEU n 1 25 ARG n 1 26 ASP n 1 27 VAL n 1 28 GLY n 1 29 ASP n 1 30 TRP n 1 31 ARG n 1 32 LYS n 1 33 ASN n 1 34 ILE n 1 35 GLU n 1 36 GLU n 1 37 LYS n 1 38 SER n 1 39 GLY n 1 40 MET n 1 41 GLU n 1 42 GLY n 1 43 ARG n 1 44 LYS n 1 45 LYS n 1 46 MET n 1 47 PHE n 1 48 GLU n 1 49 ALA n 1 50 GLY n 1 51 GLU n 1 52 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 131 131 LYS LYS A . n A 1 2 VAL 2 132 132 VAL VAL A . n A 1 3 ASN 3 133 133 ASN ASN A . n A 1 4 MET 4 134 134 MET MET A . n A 1 5 ASP 5 135 135 ASP ASP A . n A 1 6 LEU 6 136 136 LEU LEU A . n A 1 7 ARG 7 137 137 ARG ARG A . n A 1 8 ALA 8 138 138 ALA ALA A . n A 1 9 ASN 9 139 139 ASN ASN A . n A 1 10 LEU 10 140 140 LEU LEU A . n A 1 11 LYS 11 141 141 LYS LYS A . n A 1 12 GLN 12 142 142 GLN GLN A . n A 1 13 VAL 13 143 143 VAL VAL A . n A 1 14 LYS 14 144 144 LYS LYS A . n A 1 15 LYS 15 145 145 LYS LYS A . n A 1 16 GLU 16 146 146 GLU GLU A . n A 1 17 ASP 17 147 147 ASP ASP A . n A 1 18 THR 18 148 148 THR THR A . n A 1 19 GLU 19 149 149 GLU GLU A . n A 1 20 LYS 20 150 150 LYS LYS A . n A 1 21 GLU 21 151 151 GLU GLU A . n A 1 22 LYS 22 152 152 LYS LYS A . n A 1 23 ASP 23 153 153 ASP ASP A . n A 1 24 LEU 24 154 154 LEU LEU A . n A 1 25 ARG 25 155 155 ARG ARG A . n A 1 26 ASP 26 156 156 ASP ASP A . n A 1 27 VAL 27 157 157 VAL VAL A . n A 1 28 GLY 28 158 158 GLY GLY A . n A 1 29 ASP 29 159 159 ASP ASP A . n A 1 30 TRP 30 160 160 TRP TRP A . n A 1 31 ARG 31 161 161 ARG ARG A . n A 1 32 LYS 32 162 162 LYS LYS A . n A 1 33 ASN 33 163 163 ASN ASN A . n A 1 34 ILE 34 164 164 ILE ILE A . n A 1 35 GLU 35 165 165 GLU GLU A . n A 1 36 GLU 36 166 166 GLU GLU A . n A 1 37 LYS 37 167 167 LYS LYS A . n A 1 38 SER 38 168 168 SER SER A . n A 1 39 GLY 39 169 169 GLY GLY A . n A 1 40 MET 40 170 170 MET MET A . n A 1 41 GLU 41 171 171 GLU GLU A . n A 1 42 GLY 42 172 172 GLY GLY A . n A 1 43 ARG 43 173 173 ARG ARG A . n A 1 44 LYS 44 174 174 LYS LYS A . n A 1 45 LYS 45 175 175 LYS LYS A . n A 1 46 MET 46 176 176 MET MET A . n A 1 47 PHE 47 177 177 PHE PHE A . n A 1 48 GLU 48 178 178 GLU GLU A . n A 1 49 ALA 49 179 179 ALA ALA A . n A 1 50 GLY 50 180 180 GLY GLY A . n A 1 51 GLU 51 181 181 GLU GLU A . n A 1 52 SER 52 182 182 SER SER A . n # _exptl.entry_id 1VDI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1VDI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1VDI _struct.title 'Solution structure of actin-binding domain of troponin in Ca2+-free state' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VDI _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'troponin, actin, tropomyosin, CONTRACTILE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNI2_CHICK _struct_ref.pdbx_db_accession P68246 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KVNMDLRANLKQVKKEDTEKEKDLRDVGDWRKNIEEKSGMEGRKKMFEAGES _struct_ref.pdbx_align_begin 131 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VDI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P68246 _struct_ref_seq.db_align_beg 131 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 131 _struct_ref_seq.pdbx_auth_seq_align_end 182 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 1 ? LYS A 11 ? LYS A 131 LYS A 141 1 ? 11 HELX_P HELX_P2 2 VAL A 27 ? LYS A 37 ? VAL A 157 LYS A 167 1 ? 11 HELX_P HELX_P3 3 SER A 38 ? GLU A 48 ? SER A 168 GLU A 178 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 14 ? LYS A 15 ? LYS A 144 LYS A 145 A 2 GLU A 21 ? LYS A 22 ? GLU A 151 LYS A 152 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 14 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 144 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 152 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ARG 161 ? ? H A GLU 165 ? ? 1.59 2 2 O A ARG 161 ? ? H A GLU 165 ? ? 1.52 3 3 O A LEU 154 ? ? H A VAL 157 ? ? 1.53 4 3 O A ARG 161 ? ? H A GLU 165 ? ? 1.60 5 4 O A ARG 161 ? ? H A GLU 165 ? ? 1.59 6 6 O A ARG 155 ? ? H A VAL 157 ? ? 1.57 7 6 O A ARG 161 ? ? H A GLU 165 ? ? 1.59 8 7 O A ARG 173 ? ? H A MET 176 ? ? 1.60 9 9 O A ARG 155 ? ? H A VAL 157 ? ? 1.55 10 9 O A ARG 161 ? ? H A GLU 165 ? ? 1.58 11 12 O A ARG 161 ? ? H A GLU 165 ? ? 1.53 12 13 O A LEU 154 ? ? H A VAL 157 ? ? 1.30 13 14 O A ARG 173 ? ? H A MET 176 ? ? 1.59 14 15 O A ARG 161 ? ? H A GLU 165 ? ? 1.51 15 17 O A GLU 165 ? ? H A GLY 169 ? ? 1.57 16 17 O A ILE 164 ? ? H A SER 168 ? ? 1.58 17 17 O A ARG 161 ? ? H A GLU 165 ? ? 1.60 18 19 O A VAL 157 ? ? H A ARG 161 ? ? 1.60 19 20 O A LEU 154 ? ? H A VAL 157 ? ? 1.54 20 20 O A ARG 161 ? ? H A GLU 165 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 133 ? ? -37.23 -33.01 2 1 LYS A 141 ? ? -53.24 -105.19 3 1 GLN A 142 ? ? 73.36 161.81 4 1 VAL A 143 ? ? -39.80 113.25 5 1 ASP A 156 ? ? -71.44 45.58 6 1 VAL A 157 ? ? -67.32 -77.75 7 1 ARG A 161 ? ? -60.03 -70.12 8 1 LYS A 162 ? ? -28.84 -46.17 9 1 ASN A 163 ? ? -63.12 -83.00 10 1 LYS A 167 ? ? -105.77 74.48 11 1 SER A 168 ? ? -168.41 -82.01 12 1 GLU A 171 ? ? -54.14 -72.28 13 1 ARG A 173 ? ? -44.83 -75.84 14 1 PHE A 177 ? ? -178.40 73.72 15 1 ALA A 179 ? ? 60.27 75.65 16 2 ASN A 133 ? ? -35.42 -36.55 17 2 LYS A 141 ? ? -79.38 -106.79 18 2 GLN A 142 ? ? 66.47 -176.45 19 2 LYS A 144 ? ? -110.72 66.32 20 2 ASP A 147 ? ? 157.51 -87.91 21 2 THR A 148 ? ? -152.62 -51.65 22 2 ARG A 155 ? ? -25.53 138.46 23 2 ASP A 156 ? ? 84.75 -5.62 24 2 VAL A 157 ? ? -37.90 -81.21 25 2 TRP A 160 ? ? -38.46 -32.06 26 2 ARG A 161 ? ? -73.82 -77.55 27 2 LYS A 162 ? ? -32.80 -37.17 28 2 ASN A 163 ? ? -61.80 -74.54 29 2 GLU A 166 ? ? -91.86 -77.68 30 2 SER A 168 ? ? -108.95 65.51 31 2 PHE A 177 ? ? -164.23 71.20 32 3 ASN A 133 ? ? -38.64 -31.06 33 3 LYS A 141 ? ? -58.56 -87.45 34 3 GLN A 142 ? ? 74.14 65.54 35 3 VAL A 143 ? ? 45.06 93.32 36 3 LYS A 145 ? ? -160.97 -160.97 37 3 GLU A 146 ? ? 173.25 -30.39 38 3 LEU A 154 ? ? -124.27 -167.04 39 3 VAL A 157 ? ? -30.23 -72.12 40 3 ARG A 161 ? ? -52.77 -72.23 41 3 LYS A 162 ? ? -22.94 -51.35 42 3 ASN A 163 ? ? -63.08 -82.04 43 3 LYS A 167 ? ? -38.49 -74.94 44 3 ARG A 173 ? ? -74.66 -70.75 45 3 PHE A 177 ? ? -91.86 -65.66 46 3 GLU A 178 ? ? 74.89 -3.11 47 3 ALA A 179 ? ? 35.63 74.98 48 4 ASN A 133 ? ? -36.35 -35.09 49 4 GLN A 142 ? ? -132.02 -43.41 50 4 ASP A 147 ? ? -170.23 134.86 51 4 THR A 148 ? ? -27.60 -49.13 52 4 ARG A 155 ? ? -38.38 158.16 53 4 VAL A 157 ? ? -26.32 -55.27 54 4 LYS A 162 ? ? -28.04 -44.28 55 4 ASN A 163 ? ? -64.21 -78.12 56 4 GLU A 166 ? ? -67.13 -73.39 57 4 LYS A 167 ? ? -49.25 -86.62 58 4 SER A 168 ? ? -65.37 74.64 59 4 PHE A 177 ? ? -163.81 71.05 60 4 ALA A 179 ? ? 46.98 78.37 61 4 GLU A 181 ? ? -165.41 94.21 62 5 LEU A 136 ? ? -72.47 -70.24 63 5 LEU A 140 ? ? -75.63 -87.67 64 5 GLN A 142 ? ? 69.87 -56.01 65 5 GLU A 146 ? ? -154.31 18.58 66 5 ASP A 147 ? ? 153.89 162.02 67 5 LYS A 150 ? ? -163.30 86.38 68 5 ARG A 155 ? ? -31.53 140.45 69 5 ASP A 156 ? ? 84.08 8.50 70 5 ARG A 161 ? ? -63.57 -70.48 71 5 LYS A 162 ? ? -25.24 -54.56 72 5 SER A 168 ? ? -151.41 -73.01 73 5 LYS A 174 ? ? -38.68 -35.20 74 5 PHE A 177 ? ? -96.20 -65.06 75 5 GLU A 178 ? ? 75.95 -5.02 76 5 ALA A 179 ? ? 38.09 -97.96 77 6 GLN A 142 ? ? 173.98 106.75 78 6 VAL A 143 ? ? 43.22 94.12 79 6 GLU A 146 ? ? -144.39 11.27 80 6 ASP A 147 ? ? 153.96 -171.62 81 6 THR A 148 ? ? -51.39 -83.68 82 6 GLU A 149 ? ? -69.65 58.71 83 6 LYS A 150 ? ? 177.67 74.30 84 6 ASP A 156 ? ? -69.62 56.42 85 6 LYS A 162 ? ? -28.30 -44.36 86 6 ASN A 163 ? ? -66.79 -79.34 87 6 GLU A 166 ? ? -68.35 -78.17 88 6 LYS A 174 ? ? -39.06 -34.87 89 6 PHE A 177 ? ? -96.26 -64.80 90 6 GLU A 178 ? ? 74.56 -2.87 91 6 ALA A 179 ? ? 35.83 58.82 92 7 ASN A 133 ? ? -38.31 -31.27 93 7 ARG A 137 ? ? -40.80 -76.45 94 7 ASN A 139 ? ? -36.56 -35.43 95 7 LEU A 140 ? ? -81.68 -76.63 96 7 LYS A 141 ? ? -52.39 -78.54 97 7 GLN A 142 ? ? 33.68 72.67 98 7 VAL A 143 ? ? 59.05 113.42 99 7 LYS A 145 ? ? -170.96 140.38 100 7 ASP A 147 ? ? 177.35 -75.71 101 7 THR A 148 ? ? -168.36 -55.71 102 7 VAL A 157 ? ? -35.97 -75.16 103 7 LYS A 162 ? ? -23.31 -53.20 104 7 ILE A 164 ? ? -79.85 24.76 105 7 GLU A 171 ? ? -60.08 -77.50 106 7 ARG A 173 ? ? -59.19 -71.66 107 7 PHE A 177 ? ? -173.35 57.65 108 7 GLU A 178 ? ? -31.95 91.46 109 7 ALA A 179 ? ? -69.84 61.02 110 7 GLU A 181 ? ? -116.60 66.61 111 8 ASN A 133 ? ? -36.48 -33.71 112 8 LEU A 136 ? ? -71.64 -71.31 113 8 LEU A 140 ? ? -74.87 -80.85 114 8 LYS A 141 ? ? -38.52 -79.20 115 8 GLN A 142 ? ? 68.73 64.06 116 8 VAL A 143 ? ? 42.26 93.69 117 8 GLU A 146 ? ? -145.95 15.02 118 8 ASP A 147 ? ? 167.57 -158.76 119 8 LYS A 150 ? ? -160.75 62.32 120 8 VAL A 157 ? ? -38.48 -76.08 121 8 LYS A 162 ? ? -29.01 -37.18 122 8 ILE A 164 ? ? -84.11 31.43 123 8 GLU A 165 ? ? -137.47 -38.76 124 8 LYS A 167 ? ? -88.79 -78.01 125 8 GLU A 178 ? ? 11.51 68.65 126 9 GLN A 142 ? ? 43.21 -94.93 127 9 GLU A 146 ? ? -155.34 19.47 128 9 ASP A 147 ? ? 157.04 -168.84 129 9 GLU A 151 ? ? -169.16 58.11 130 9 ASP A 156 ? ? -67.51 59.86 131 9 LYS A 162 ? ? -28.55 -43.60 132 9 ASN A 163 ? ? -66.31 -79.45 133 9 GLU A 166 ? ? -70.68 -79.07 134 9 LYS A 167 ? ? -48.77 -96.18 135 9 SER A 168 ? ? -63.85 75.79 136 9 PHE A 177 ? ? -166.13 70.92 137 9 ALA A 179 ? ? 61.62 121.53 138 9 GLU A 181 ? ? -90.73 -61.32 139 10 ASN A 133 ? ? -37.11 -33.58 140 10 ARG A 137 ? ? -42.17 -75.48 141 10 ASN A 139 ? ? -37.58 -33.83 142 10 GLN A 142 ? ? 177.28 100.11 143 10 VAL A 143 ? ? 48.41 101.34 144 10 GLU A 146 ? ? -156.17 20.94 145 10 ASP A 147 ? ? 166.90 -161.30 146 10 ARG A 155 ? ? -45.51 171.44 147 10 LYS A 162 ? ? -30.98 -35.08 148 10 SER A 168 ? ? -102.51 62.35 149 10 PHE A 177 ? ? -166.00 73.99 150 10 ALA A 179 ? ? 60.02 88.07 151 10 GLU A 181 ? ? 65.97 98.22 152 11 ASN A 133 ? ? -35.10 -37.26 153 11 ASN A 139 ? ? -38.08 -35.05 154 11 GLN A 142 ? ? -171.88 -39.06 155 11 VAL A 143 ? ? -173.77 84.39 156 11 GLU A 146 ? ? -154.73 19.08 157 11 ASP A 147 ? ? 156.20 -169.64 158 11 GLU A 151 ? ? -172.26 58.75 159 11 LEU A 154 ? ? -168.13 -163.86 160 11 ARG A 155 ? ? -25.30 137.52 161 11 ASP A 156 ? ? 83.44 -5.85 162 11 VAL A 157 ? ? -35.53 -77.08 163 11 TRP A 160 ? ? -38.90 -31.79 164 11 ARG A 161 ? ? -73.84 -70.89 165 11 LYS A 162 ? ? -38.14 -28.63 166 11 ASN A 163 ? ? -69.82 -70.92 167 11 SER A 168 ? ? -39.26 -74.47 168 11 MET A 170 ? ? -38.78 -88.29 169 11 GLU A 178 ? ? 51.22 15.68 170 11 ALA A 179 ? ? 27.76 60.61 171 12 ASN A 133 ? ? -37.10 -32.87 172 12 LYS A 141 ? ? -69.40 -138.58 173 12 GLN A 142 ? ? 91.73 53.09 174 12 VAL A 143 ? ? 67.91 119.44 175 12 GLU A 146 ? ? -145.53 12.71 176 12 ASP A 147 ? ? 157.61 -167.86 177 12 THR A 148 ? ? -48.57 -92.63 178 12 LYS A 150 ? ? -56.27 88.38 179 12 LEU A 154 ? ? -162.39 -164.55 180 12 ARG A 155 ? ? -28.62 135.52 181 12 ASP A 156 ? ? 86.74 -6.07 182 12 VAL A 157 ? ? -36.21 -75.41 183 12 TRP A 160 ? ? -35.62 -36.71 184 12 ARG A 161 ? ? -72.62 -77.46 185 12 LYS A 162 ? ? -31.36 -39.43 186 12 ASN A 163 ? ? -61.62 -75.24 187 12 GLU A 166 ? ? -87.14 -75.63 188 12 GLU A 171 ? ? -57.70 -81.80 189 12 GLU A 178 ? ? 30.09 89.04 190 13 ASN A 133 ? ? -37.71 -31.84 191 13 GLN A 142 ? ? 178.89 48.69 192 13 VAL A 143 ? ? 67.90 73.60 193 13 ASP A 147 ? ? 172.08 -149.61 194 13 THR A 148 ? ? -70.44 -98.69 195 13 LYS A 150 ? ? -65.52 74.07 196 13 VAL A 157 ? ? -37.98 -71.72 197 13 ARG A 161 ? ? -58.84 -72.13 198 13 LYS A 162 ? ? -22.35 -53.86 199 13 GLU A 178 ? ? 28.02 86.82 200 14 GLN A 142 ? ? -179.71 93.47 201 14 VAL A 143 ? ? 52.15 103.90 202 14 LYS A 144 ? ? -107.91 64.97 203 14 GLU A 146 ? ? -155.47 -40.86 204 14 THR A 148 ? ? -39.39 -27.69 205 14 GLU A 151 ? ? 177.47 112.60 206 14 ARG A 155 ? ? -36.13 152.79 207 14 VAL A 157 ? ? -25.04 -58.91 208 14 LYS A 162 ? ? -38.37 -30.10 209 14 ASN A 163 ? ? -70.63 -74.27 210 14 ILE A 164 ? ? -79.81 23.74 211 14 GLU A 171 ? ? -56.67 -83.04 212 14 ARG A 173 ? ? -50.93 -70.95 213 14 PHE A 177 ? ? -177.59 66.79 214 14 GLU A 178 ? ? -37.89 -30.27 215 14 ALA A 179 ? ? 74.33 56.42 216 14 GLU A 181 ? ? 47.81 94.78 217 15 ASN A 139 ? ? -37.79 -33.77 218 15 LEU A 140 ? ? -82.98 -76.08 219 15 GLN A 142 ? ? 32.03 85.74 220 15 VAL A 143 ? ? 61.53 125.84 221 15 GLU A 146 ? ? -149.04 14.96 222 15 ASP A 147 ? ? 151.76 142.77 223 15 LYS A 150 ? ? -172.54 105.76 224 15 ASP A 156 ? ? 84.91 -1.79 225 15 ASP A 159 ? ? -35.94 -84.05 226 15 ARG A 161 ? ? -63.81 -86.68 227 15 LYS A 162 ? ? -27.90 -40.90 228 15 ASN A 163 ? ? -52.77 -72.90 229 15 SER A 168 ? ? -176.91 35.93 230 15 PHE A 177 ? ? -164.22 71.21 231 15 GLU A 178 ? ? -39.27 97.56 232 15 ALA A 179 ? ? -104.21 73.66 233 16 ASN A 133 ? ? -38.12 -31.09 234 16 GLN A 142 ? ? -152.83 -43.82 235 16 VAL A 143 ? ? -166.83 110.91 236 16 LYS A 145 ? ? -179.30 -169.21 237 16 GLU A 146 ? ? -166.95 -38.45 238 16 GLU A 149 ? ? -90.62 31.25 239 16 LYS A 150 ? ? -164.60 76.45 240 16 VAL A 157 ? ? -24.58 -67.78 241 16 LYS A 162 ? ? -25.22 -48.52 242 16 LYS A 167 ? ? -90.11 40.40 243 16 SER A 168 ? ? -133.50 -62.04 244 16 GLU A 171 ? ? -70.75 -70.08 245 16 GLU A 178 ? ? 27.65 79.72 246 16 ALA A 179 ? ? -168.61 64.46 247 17 ASN A 133 ? ? -36.94 -33.67 248 17 GLN A 142 ? ? -164.00 -41.35 249 17 VAL A 143 ? ? -170.58 89.83 250 17 LYS A 144 ? ? -106.81 69.26 251 17 GLU A 146 ? ? -150.07 15.17 252 17 ASP A 147 ? ? 152.04 -172.54 253 17 LEU A 154 ? ? -160.48 -165.60 254 17 ARG A 155 ? ? -30.02 143.56 255 17 ASP A 156 ? ? 81.54 -6.72 256 17 VAL A 157 ? ? -39.36 -75.05 257 17 LYS A 162 ? ? -32.68 -38.78 258 17 ASN A 163 ? ? -65.40 -75.63 259 17 GLU A 166 ? ? -70.51 -76.13 260 17 LYS A 167 ? ? -38.19 -31.66 261 17 PHE A 177 ? ? -96.53 -63.23 262 17 GLU A 178 ? ? 73.46 -2.60 263 17 ALA A 179 ? ? 35.15 50.30 264 18 ASN A 139 ? ? -38.41 -70.61 265 18 LYS A 141 ? ? -85.97 -116.10 266 18 GLN A 142 ? ? 35.57 91.79 267 18 VAL A 143 ? ? 53.57 78.64 268 18 GLU A 146 ? ? -174.90 -35.50 269 18 GLU A 151 ? ? -162.49 107.92 270 18 VAL A 157 ? ? -34.48 -71.82 271 18 LYS A 162 ? ? -23.71 -54.30 272 18 PHE A 177 ? ? -169.76 76.78 273 18 GLU A 178 ? ? -40.69 104.25 274 18 GLU A 181 ? ? 62.16 -79.91 275 19 ASN A 133 ? ? -36.87 -33.26 276 19 ASN A 139 ? ? -36.08 -39.36 277 19 GLN A 142 ? ? -175.66 54.01 278 19 VAL A 143 ? ? 65.69 77.36 279 19 GLU A 146 ? ? -146.25 14.69 280 19 ASP A 147 ? ? 169.67 -156.10 281 19 LYS A 152 ? ? -163.71 112.96 282 19 ARG A 155 ? ? -38.42 94.59 283 19 ASP A 156 ? ? 139.34 -9.37 284 19 VAL A 157 ? ? -24.66 -63.01 285 19 LYS A 162 ? ? -28.35 -54.31 286 19 GLU A 178 ? ? 71.98 -64.63 287 19 ALA A 179 ? ? 83.21 79.18 288 19 GLU A 181 ? ? -124.61 -56.42 289 20 VAL A 132 ? ? -68.72 -70.29 290 20 ASN A 133 ? ? -35.91 -34.34 291 20 LEU A 140 ? ? -72.64 -86.39 292 20 LYS A 141 ? ? -59.65 -83.31 293 20 GLN A 142 ? ? 79.66 58.27 294 20 VAL A 143 ? ? 61.94 130.11 295 20 ASP A 147 ? ? 164.61 -80.58 296 20 GLU A 151 ? ? -151.79 74.61 297 20 ARG A 161 ? ? -66.31 -72.67 298 20 LYS A 162 ? ? -27.02 -45.82 299 20 ASN A 163 ? ? -62.78 -79.00 300 20 SER A 168 ? ? -170.52 -60.72 301 20 LYS A 174 ? ? -37.65 -32.51 302 20 PHE A 177 ? ? -102.22 -65.60 303 20 GLU A 178 ? ? 73.55 -1.44 304 20 ALA A 179 ? ? 36.42 80.65 # _pdbx_nmr_ensemble.entry_id 1VDI _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TRP N N N N 266 TRP CA C N S 267 TRP C C N N 268 TRP O O N N 269 TRP CB C N N 270 TRP CG C Y N 271 TRP CD1 C Y N 272 TRP CD2 C Y N 273 TRP NE1 N Y N 274 TRP CE2 C Y N 275 TRP CE3 C Y N 276 TRP CZ2 C Y N 277 TRP CZ3 C Y N 278 TRP CH2 C Y N 279 TRP OXT O N N 280 TRP H H N N 281 TRP H2 H N N 282 TRP HA H N N 283 TRP HB2 H N N 284 TRP HB3 H N N 285 TRP HD1 H N N 286 TRP HE1 H N N 287 TRP HE3 H N N 288 TRP HZ2 H N N 289 TRP HZ3 H N N 290 TRP HH2 H N N 291 TRP HXT H N N 292 VAL N N N N 293 VAL CA C N S 294 VAL C C N N 295 VAL O O N N 296 VAL CB C N N 297 VAL CG1 C N N 298 VAL CG2 C N N 299 VAL OXT O N N 300 VAL H H N N 301 VAL H2 H N N 302 VAL HA H N N 303 VAL HB H N N 304 VAL HG11 H N N 305 VAL HG12 H N N 306 VAL HG13 H N N 307 VAL HG21 H N N 308 VAL HG22 H N N 309 VAL HG23 H N N 310 VAL HXT H N N 311 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 THR N CA sing N N 237 THR N H sing N N 238 THR N H2 sing N N 239 THR CA C sing N N 240 THR CA CB sing N N 241 THR CA HA sing N N 242 THR C O doub N N 243 THR C OXT sing N N 244 THR CB OG1 sing N N 245 THR CB CG2 sing N N 246 THR CB HB sing N N 247 THR OG1 HG1 sing N N 248 THR CG2 HG21 sing N N 249 THR CG2 HG22 sing N N 250 THR CG2 HG23 sing N N 251 THR OXT HXT sing N N 252 TRP N CA sing N N 253 TRP N H sing N N 254 TRP N H2 sing N N 255 TRP CA C sing N N 256 TRP CA CB sing N N 257 TRP CA HA sing N N 258 TRP C O doub N N 259 TRP C OXT sing N N 260 TRP CB CG sing N N 261 TRP CB HB2 sing N N 262 TRP CB HB3 sing N N 263 TRP CG CD1 doub Y N 264 TRP CG CD2 sing Y N 265 TRP CD1 NE1 sing Y N 266 TRP CD1 HD1 sing N N 267 TRP CD2 CE2 doub Y N 268 TRP CD2 CE3 sing Y N 269 TRP NE1 CE2 sing Y N 270 TRP NE1 HE1 sing N N 271 TRP CE2 CZ2 sing Y N 272 TRP CE3 CZ3 doub Y N 273 TRP CE3 HE3 sing N N 274 TRP CZ2 CH2 doub Y N 275 TRP CZ2 HZ2 sing N N 276 TRP CZ3 CH2 sing Y N 277 TRP CZ3 HZ3 sing N N 278 TRP CH2 HH2 sing N N 279 TRP OXT HXT sing N N 280 VAL N CA sing N N 281 VAL N H sing N N 282 VAL N H2 sing N N 283 VAL CA C sing N N 284 VAL CA CB sing N N 285 VAL CA HA sing N N 286 VAL C O doub N N 287 VAL C OXT sing N N 288 VAL CB CG1 sing N N 289 VAL CB CG2 sing N N 290 VAL CB HB sing N N 291 VAL CG1 HG11 sing N N 292 VAL CG1 HG12 sing N N 293 VAL CG1 HG13 sing N N 294 VAL CG2 HG21 sing N N 295 VAL CG2 HG22 sing N N 296 VAL CG2 HG23 sing N N 297 VAL OXT HXT sing N N 298 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 750 # _atom_sites.entry_id 1VDI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_