data_1VIF # _entry.id 1VIF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VIF pdb_00001vif 10.2210/pdb1vif/pdb WWPDB D_1000177042 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VIF _pdbx_database_status.recvd_initial_deposition_date 1996-10-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Narayana, N.' 1 'Matthews, D.A.' 2 'Howell, E.E.' 3 'Xuong, N.-H.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.' Nat.Struct.Biol. 2 1018 1025 1995 NSBIEW US 1072-8368 2024 ? 7583655 10.1038/nsb1195-1018 1 'Does R67 Dihydrofolate Reductase Possess a Proton Donor?' Adv.Exp.Med.Biol. 338 493 ? 1993 AEMBAP US 0065-2598 0412 ? ? ? 2 ;Construction of a Synthetic Gene for an R-Plasmid-Encoded Dihydrofolate Reductase and Studies on the Role of the N-Terminus in the Protein ; Biochemistry 30 10895 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 3 'Crystal Structure of a Novel Trimethoprim-Resistant Dihydrofolate Reductase Specified in Escherichia Coli by R-Plasmid R67' Biochemistry 25 4194 ? 1986 BICHAW US 0006-2960 0033 ? ? ? 4 'The Amino Acid Sequence of the Trimethoprim-Resistant Dihydrofolate Reductase Specified in Escherichia Coli by R-Plasmid R67' J.Biol.Chem. 254 10857 ? 1979 JBCHA3 US 0021-9258 0071 ? ? ? 5 'Trimethoprim Resistance Determined by R Factors' Br.Med.J. 1 726 ? 1972 BMJOAE UK 0007-1447 2110 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Narayana, N.' 1 ? primary 'Matthews, D.A.' 2 ? primary 'Howell, E.E.' 3 ? primary 'Nguyen-huu, X.' 4 ? 1 'Holland, J.C.' 5 ? 1 'Linn, C.E.' 6 ? 1 'Digiammarino, E.' 7 ? 1 'Nichols, R.' 8 ? 1 'Howell, E.E.' 9 ? 2 'Reece, L.J.' 10 ? 2 'Nichols, R.' 11 ? 2 'Ogden, R.C.' 12 ? 2 'Howell, E.E.' 13 ? 3 'Matthews, D.A.' 14 ? 3 'Smith, S.L.' 15 ? 3 'Baccanari, D.P.' 16 ? 3 'Burchall, J.J.' 17 ? 3 'Oatley, S.J.' 18 ? 3 'Kraut, J.' 19 ? 4 'Stone, D.' 20 ? 4 'Smith, S.L.' 21 ? 5 'Fleming, M.P.' 22 ? 5 'Datta, N.' 23 ? 5 'Gruneberg, R.N.' 24 ? # _cell.entry_id 1VIF _cell.length_a 68.750 _cell.length_b 68.750 _cell.length_c 52.590 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VIF _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DIHYDROFOLATE REDUCTASE' 6732.528 1 1.5.1.3 ? ? ? 2 non-polymer syn 'FOLIC ACID' 441.397 1 ? ? ? ? 3 water nat water 18.015 44 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'R67 DHFR' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN _entity_poly.pdbx_seq_one_letter_code_can VFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PHE n 1 3 PRO n 1 4 SER n 1 5 ASN n 1 6 ALA n 1 7 THR n 1 8 PHE n 1 9 GLY n 1 10 MET n 1 11 GLY n 1 12 ASP n 1 13 ARG n 1 14 VAL n 1 15 ARG n 1 16 LYS n 1 17 LYS n 1 18 SER n 1 19 GLY n 1 20 ALA n 1 21 ALA n 1 22 TRP n 1 23 GLN n 1 24 GLY n 1 25 GLN n 1 26 ILE n 1 27 VAL n 1 28 GLY n 1 29 TRP n 1 30 TYR n 1 31 CYS n 1 32 THR n 1 33 ASN n 1 34 LEU n 1 35 THR n 1 36 PRO n 1 37 GLU n 1 38 GLY n 1 39 TYR n 1 40 ALA n 1 41 VAL n 1 42 GLU n 1 43 SER n 1 44 GLU n 1 45 ALA n 1 46 HIS n 1 47 PRO n 1 48 GLY n 1 49 SER n 1 50 VAL n 1 51 GLN n 1 52 ILE n 1 53 TYR n 1 54 PRO n 1 55 VAL n 1 56 ALA n 1 57 ALA n 1 58 LEU n 1 59 GLU n 1 60 ARG n 1 61 ILE n 1 62 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'SYNTHETIC GENE' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'TMP-RESISTANT, CONTAINING R67 DHFR OVERPRODUCING PLASMID PLZ1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type BACTERIA _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PLZ1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYR21_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00383 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MERSSNEVSNPVAGNFVFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VIF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00383 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 17 _struct_ref_seq.pdbx_auth_seq_align_end 78 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FOL non-polymer . 'FOLIC ACID' ? 'C19 H19 N7 O6' 441.397 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1VIF _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.0 _exptl_crystal.density_percent_sol 40. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_pH_range 6.8-8.0 _exptl_crystal_grow.pdbx_details ;CRYSTALS WERE GROWN FROM HANGING- DROPS CONTAINING PROTEIN AT A FINAL CONCENTRATION OF ABOUT 18 MG/ML, 30 MM FOLATE, 40 MM BICINE BUFFER AT PH 8.0 AND 18% 2-METHYL-2,4-PENTANE DIOL (MPD). DROPS WERE EQUILIBRATED AGAINST A RESERVOIR CONTAINING 100 MM KH2PO4 BUFFER AT PH 6.8 AND 50% MPD. THE CRYSTALS WERE FURTHER SOAKED IN 100 MM FOLATE FOR 3 DAYS., vapor diffusion - hanging drop ; # _diffrn.id 1 _diffrn.ambient_temp 277 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type 'XUONG-HAMLIN MULTIWIRE' _diffrn_detector.pdbx_collection_date 1992-03-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1VIF _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 10. _reflns.d_resolution_high 1.8 _reflns.number_obs 6094 _reflns.number_all ? _reflns.percent_possible_obs 100. _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.0550000 _reflns.pdbx_netI_over_sigmaI 12. _reflns.B_iso_Wilson_estimate 10.7 _reflns.pdbx_redundancy 12. _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 100. _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.1600000 _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.pdbx_redundancy 8. _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1VIF _refine.ls_number_reflns_obs 6040 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs 100. _refine.ls_R_factor_obs 0.1760000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1760000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1VIE' _refine.pdbx_method_to_determine_struct 'ISOMORPHOUS REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1VIF _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 10.0 _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 457 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 44 _refine_hist.number_atoms_total 527 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.5 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 18.5 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1VIF _struct.title 'STRUCTURE OF DIHYDROFOLATE REDUCTASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VIF _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, NADP, TRIMETHOPRIM RESISTANCE METHOTREXATE RESISTANCE, ONE-CARBON METABOLISM, PLASMID' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 57 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 71 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 73 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 61 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 77 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASN _struct_mon_prot_cis.pdbx_label_seq_id_2 62 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASN _struct_mon_prot_cis.pdbx_auth_seq_id_2 78 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.13 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 58 ? ARG A 60 ? LEU A 74 ARG A 76 A 2 ARG A 13 ? LYS A 16 ? ARG A 29 LYS A 32 A 3 GLN A 23 ? TYR A 30 ? GLN A 39 TYR A 46 A 4 GLY A 38 ? SER A 43 ? GLY A 54 SER A 59 A 5 VAL A 50 ? PRO A 54 ? VAL A 66 PRO A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 59 ? O GLU A 75 N ARG A 15 ? N ARG A 31 A 2 3 O VAL A 14 ? O VAL A 30 N GLY A 24 ? N GLY A 40 A 3 4 O GLN A 25 ? O GLN A 41 N GLU A 42 ? N GLU A 58 A 4 5 O TYR A 39 ? O TYR A 55 N TYR A 53 ? N TYR A 69 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FOL _struct_site.pdbx_auth_seq_id 1 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE FOL A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 51 ? GLN A 67 . ? 1_555 ? 2 AC1 5 GLN A 51 ? GLN A 67 . ? 15_556 ? 3 AC1 5 ILE A 52 ? ILE A 68 . ? 1_555 ? 4 AC1 5 TYR A 53 ? TYR A 69 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH A 121 . ? 1_555 ? # _database_PDB_matrix.entry_id 1VIF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1VIF _atom_sites.fract_transf_matrix[1][1] 0.014545 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014545 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019015 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 17 ? ? ? A . n A 1 2 PHE 2 18 ? ? ? A . n A 1 3 PRO 3 19 19 PRO PRO A . n A 1 4 SER 4 20 20 SER SER A . n A 1 5 ASN 5 21 21 ASN ASN A . n A 1 6 ALA 6 22 22 ALA ALA A . n A 1 7 THR 7 23 23 THR THR A . n A 1 8 PHE 8 24 24 PHE PHE A . n A 1 9 GLY 9 25 25 GLY GLY A . n A 1 10 MET 10 26 26 MET MET A . n A 1 11 GLY 11 27 27 GLY GLY A . n A 1 12 ASP 12 28 28 ASP ASP A . n A 1 13 ARG 13 29 29 ARG ARG A . n A 1 14 VAL 14 30 30 VAL VAL A . n A 1 15 ARG 15 31 31 ARG ARG A . n A 1 16 LYS 16 32 32 LYS LYS A . n A 1 17 LYS 17 33 33 LYS LYS A . n A 1 18 SER 18 34 34 SER SER A . n A 1 19 GLY 19 35 35 GLY GLY A . n A 1 20 ALA 20 36 36 ALA ALA A . n A 1 21 ALA 21 37 37 ALA ALA A . n A 1 22 TRP 22 38 38 TRP TRP A . n A 1 23 GLN 23 39 39 GLN GLN A . n A 1 24 GLY 24 40 40 GLY GLY A . n A 1 25 GLN 25 41 41 GLN GLN A . n A 1 26 ILE 26 42 42 ILE ILE A . n A 1 27 VAL 27 43 43 VAL VAL A . n A 1 28 GLY 28 44 44 GLY GLY A . n A 1 29 TRP 29 45 45 TRP TRP A . n A 1 30 TYR 30 46 46 TYR TYR A . n A 1 31 CYS 31 47 47 CYS CYS A . n A 1 32 THR 32 48 48 THR THR A . n A 1 33 ASN 33 49 49 ASN ASN A . n A 1 34 LEU 34 50 50 LEU LEU A . n A 1 35 THR 35 51 51 THR THR A . n A 1 36 PRO 36 52 52 PRO PRO A . n A 1 37 GLU 37 53 53 GLU GLU A . n A 1 38 GLY 38 54 54 GLY GLY A . n A 1 39 TYR 39 55 55 TYR TYR A . n A 1 40 ALA 40 56 56 ALA ALA A . n A 1 41 VAL 41 57 57 VAL VAL A . n A 1 42 GLU 42 58 58 GLU GLU A . n A 1 43 SER 43 59 59 SER SER A . n A 1 44 GLU 44 60 60 GLU GLU A . n A 1 45 ALA 45 61 61 ALA ALA A . n A 1 46 HIS 46 62 62 HIS HIS A . n A 1 47 PRO 47 63 63 PRO PRO A . n A 1 48 GLY 48 64 64 GLY GLY A . n A 1 49 SER 49 65 65 SER SER A . n A 1 50 VAL 50 66 66 VAL VAL A . n A 1 51 GLN 51 67 67 GLN GLN A . n A 1 52 ILE 52 68 68 ILE ILE A . n A 1 53 TYR 53 69 69 TYR TYR A . n A 1 54 PRO 54 70 70 PRO PRO A . n A 1 55 VAL 55 71 71 VAL VAL A . n A 1 56 ALA 56 72 72 ALA ALA A . n A 1 57 ALA 57 73 73 ALA ALA A . n A 1 58 LEU 58 74 74 LEU LEU A . n A 1 59 GLU 59 75 75 GLU GLU A . n A 1 60 ARG 60 76 76 ARG ARG A . n A 1 61 ILE 61 77 77 ILE ILE A . n A 1 62 ASN 62 78 78 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FOL 1 1 1 FOL FOL A . C 3 HOH 1 81 81 HOH HOH A . C 3 HOH 2 82 82 HOH HOH A . C 3 HOH 3 83 83 HOH HOH A . C 3 HOH 4 84 84 HOH HOH A . C 3 HOH 5 85 85 HOH HOH A . C 3 HOH 6 86 86 HOH HOH A . C 3 HOH 7 87 87 HOH HOH A . C 3 HOH 8 88 88 HOH HOH A . C 3 HOH 9 89 89 HOH HOH A . C 3 HOH 10 90 90 HOH HOH A . C 3 HOH 11 91 91 HOH HOH A . C 3 HOH 12 92 92 HOH HOH A . C 3 HOH 13 93 93 HOH HOH A . C 3 HOH 14 94 94 HOH HOH A . C 3 HOH 15 95 95 HOH HOH A . C 3 HOH 16 96 96 HOH HOH A . C 3 HOH 17 97 97 HOH HOH A . C 3 HOH 18 98 98 HOH HOH A . C 3 HOH 19 99 99 HOH HOH A . C 3 HOH 20 100 100 HOH HOH A . C 3 HOH 21 101 101 HOH HOH A . C 3 HOH 22 102 102 HOH HOH A . C 3 HOH 23 103 103 HOH HOH A . C 3 HOH 24 104 104 HOH HOH A . C 3 HOH 25 105 105 HOH HOH A . C 3 HOH 26 106 106 HOH HOH A . C 3 HOH 27 107 107 HOH HOH A . C 3 HOH 28 108 108 HOH HOH A . C 3 HOH 29 109 109 HOH HOH A . C 3 HOH 30 110 110 HOH HOH A . C 3 HOH 31 111 111 HOH HOH A . C 3 HOH 32 112 112 HOH HOH A . C 3 HOH 33 113 113 HOH HOH A . C 3 HOH 34 114 114 HOH HOH A . C 3 HOH 35 115 115 HOH HOH A . C 3 HOH 36 116 116 HOH HOH A . C 3 HOH 37 117 117 HOH HOH A . C 3 HOH 38 118 118 HOH HOH A . C 3 HOH 39 119 119 HOH HOH A . C 3 HOH 40 120 120 HOH HOH A . C 3 HOH 41 121 121 HOH HOH A . C 3 HOH 42 122 122 HOH HOH A . C 3 HOH 43 123 123 HOH HOH A . C 3 HOH 44 124 124 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 15_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 52.5900000000 3 'crystal symmetry operation' 10_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 68.7500000000 0.0000000000 -1.0000000000 0.0000000000 68.7500000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+1 0.0000000000 -1.0000000000 0.0000000000 68.7500000000 -1.0000000000 0.0000000000 0.0000000000 68.7500000000 0.0000000000 0.0000000000 -1.0000000000 52.5900000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-10-22 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_initial_refinement_model 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 UCSD 'data reduction' . ? 3 UCSD 'data scaling' . ? 4 X-PLOR phasing . ? 5 # _pdbx_entry_details.entry_id 1VIF _pdbx_entry_details.compound_details ;R67 PLASMID-ENCODED DHFR HAS 78 AMINO ACID RESIDUES. THE PRESENT STUDY DESCRIBES THE TRUNCATED FORM OF R67 DHFR (62 RESIDUES) OBTAINED BY CLEAVING THE FULL-LENGTH PROTEIN AT PHE 16 USING CHYMOTRYPSIN. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;THE TWO MUTUALLY EXCLUSIVE FOLATE MOLECULES AT 1/4 OCCUPANCY ARE LABELLED AS FOL 1 WITH ALTERNATE LOCATIONS A AND B. HOWEVER, DENSITY IS SEEN ONLY FOR THE PTERIDINE PORTION. THUS ATOMIC COORDINATES FOR THE PARA AMINO BENZOYL GLUTAMATE MOIETY ARE NOT FOUND IN THIS ENTRY. THE WATER MOLECULE 124 HAS 1/2 OCCUPANCY. IT OCCUPIES THE POSITION OF O4 OF THE PTERIDINE RING IN ITS ABSENCE. ; _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 N5 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 FOL _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 A _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 121 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 ND2 A ASN 21 ? ? 1_555 ND2 A ASN 21 ? ? 8_667 1.47 2 1 OG1 A THR 48 ? ? 1_555 O A HOH 111 ? ? 13_646 1.65 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A SER 20 ? ? N A ASN 21 ? ? 1.574 1.336 0.238 0.023 Y 2 1 C A ALA 73 ? ? N A LEU 74 ? ? 1.192 1.336 -0.144 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 28 ? ? CG A ASP 28 ? ? OD1 A ASP 28 ? ? 112.22 118.30 -6.08 0.90 N 2 1 CB A ASP 28 ? ? CG A ASP 28 ? ? OD2 A ASP 28 ? ? 125.13 118.30 6.83 0.90 N 3 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.90 120.30 3.60 0.50 N 4 1 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 124.46 120.30 4.16 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 20 ? ? -63.60 15.03 2 1 ASN A 21 ? ? -170.46 -36.98 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id LEU _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 74 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -11.00 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 ALA _pdbx_validate_polymer_linkage.auth_seq_id_1 73 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 LEU _pdbx_validate_polymer_linkage.auth_seq_id_2 74 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A FOL 1 ? N10 ? B FOL 1 N10 2 1 N 1 A FOL 1 ? C11 ? B FOL 1 C11 3 1 N 1 A FOL 1 ? C12 ? B FOL 1 C12 4 1 N 1 A FOL 1 ? C13 ? B FOL 1 C13 5 1 N 1 A FOL 1 ? C14 ? B FOL 1 C14 6 1 N 1 A FOL 1 ? C15 ? B FOL 1 C15 7 1 N 1 A FOL 1 ? C16 ? B FOL 1 C16 8 1 N 1 A FOL 1 ? C ? B FOL 1 C 9 1 N 1 A FOL 1 ? O ? B FOL 1 O 10 1 N 1 A FOL 1 ? N ? B FOL 1 N 11 1 N 1 A FOL 1 ? CA ? B FOL 1 CA 12 1 N 1 A FOL 1 ? CB ? B FOL 1 CB 13 1 N 1 A FOL 1 ? CG ? B FOL 1 CG 14 1 N 1 A FOL 1 ? CD ? B FOL 1 CD 15 1 N 1 A FOL 1 ? OE1 ? B FOL 1 OE1 16 1 N 1 A FOL 1 ? OE2 ? B FOL 1 OE2 17 1 N 1 A FOL 1 ? CT ? B FOL 1 CT 18 1 N 1 A FOL 1 ? O1 ? B FOL 1 O1 19 1 N 1 A FOL 1 ? O2 ? B FOL 1 O2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 17 ? A VAL 1 2 1 Y 1 A PHE 18 ? A PHE 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FOLIC ACID' FOL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1VIE _pdbx_initial_refinement_model.details 'PDB ENTRY 1VIE' #