data_1VMG # _entry.id 1VMG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VMG pdb_00001vmg 10.2210/pdb1vmg/pdb RCSB RCSB002012 ? ? WWPDB D_1000002012 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-10-05 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-12-27 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Source and taxonomy' 5 3 'Structure model' 'Version format compliance' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 1VMG _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2004-09-24 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 358109 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein SSO3215' 11182.214 1 3.6.1.- ? ? ? 2 non-polymer syn 'LITHIUM ION' 6.941 1 ? ? ? ? 3 non-polymer syn 'UNKNOWN LIGAND' ? 1 ? ? ? ? 4 water nat water 18.015 106 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSDKIHHHHHH(MSE)DLELKELQSK(MSE)KE(MSE)YFEKDSQRGIYATFTWLVEEVGELAEALLSNNLDSIQEELA DVIAWTVSIANLEGIDIEEALKKKYKL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSDKIHHHHHHMDLELKELQSKMKEMYFEKDSQRGIYATFTWLVEEVGELAEALLSNNLDSIQEELADVIAWTVSIANL EGIDIEEALKKKYKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 358109 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'LITHIUM ION' LI 3 'UNKNOWN LIGAND' UNL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 ASP n 1 5 LYS n 1 6 ILE n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 MSE n 1 14 ASP n 1 15 LEU n 1 16 GLU n 1 17 LEU n 1 18 LYS n 1 19 GLU n 1 20 LEU n 1 21 GLN n 1 22 SER n 1 23 LYS n 1 24 MSE n 1 25 LYS n 1 26 GLU n 1 27 MSE n 1 28 TYR n 1 29 PHE n 1 30 GLU n 1 31 LYS n 1 32 ASP n 1 33 SER n 1 34 GLN n 1 35 ARG n 1 36 GLY n 1 37 ILE n 1 38 TYR n 1 39 ALA n 1 40 THR n 1 41 PHE n 1 42 THR n 1 43 TRP n 1 44 LEU n 1 45 VAL n 1 46 GLU n 1 47 GLU n 1 48 VAL n 1 49 GLY n 1 50 GLU n 1 51 LEU n 1 52 ALA n 1 53 GLU n 1 54 ALA n 1 55 LEU n 1 56 LEU n 1 57 SER n 1 58 ASN n 1 59 ASN n 1 60 LEU n 1 61 ASP n 1 62 SER n 1 63 ILE n 1 64 GLN n 1 65 GLU n 1 66 GLU n 1 67 LEU n 1 68 ALA n 1 69 ASP n 1 70 VAL n 1 71 ILE n 1 72 ALA n 1 73 TRP n 1 74 THR n 1 75 VAL n 1 76 SER n 1 77 ILE n 1 78 ALA n 1 79 ASN n 1 80 LEU n 1 81 GLU n 1 82 GLY n 1 83 ILE n 1 84 ASP n 1 85 ILE n 1 86 GLU n 1 87 GLU n 1 88 ALA n 1 89 LEU n 1 90 LYS n 1 91 LYS n 1 92 LYS n 1 93 TYR n 1 94 LYS n 1 95 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Sulfolobus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Sulfolobus solfataricus' _entity_src_gen.gene_src_strain P2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus solfataricus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273057 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LI non-polymer . 'LITHIUM ION' ? 'Li 1' 6.941 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNL non-polymer . 'UNKNOWN LIGAND' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -11 ? ? ? A . n A 1 2 GLY 2 -10 ? ? ? A . n A 1 3 SER 3 -9 ? ? ? A . n A 1 4 ASP 4 -8 ? ? ? A . n A 1 5 LYS 5 -7 ? ? ? A . n A 1 6 ILE 6 -6 ? ? ? A . n A 1 7 HIS 7 -5 ? ? ? A . n A 1 8 HIS 8 -4 ? ? ? A . n A 1 9 HIS 9 -3 ? ? ? A . n A 1 10 HIS 10 -2 ? ? ? A . n A 1 11 HIS 11 -1 ? ? ? A . n A 1 12 HIS 12 0 ? ? ? A . n A 1 13 MSE 13 1 1 MSE MSE A . n A 1 14 ASP 14 2 2 ASP ASP A . n A 1 15 LEU 15 3 3 LEU LEU A . n A 1 16 GLU 16 4 4 GLU GLU A . n A 1 17 LEU 17 5 5 LEU LEU A . n A 1 18 LYS 18 6 6 LYS LYS A . n A 1 19 GLU 19 7 7 GLU GLU A . n A 1 20 LEU 20 8 8 LEU LEU A . n A 1 21 GLN 21 9 9 GLN GLN A . n A 1 22 SER 22 10 10 SER SER A . n A 1 23 LYS 23 11 11 LYS LYS A . n A 1 24 MSE 24 12 12 MSE MSE A . n A 1 25 LYS 25 13 13 LYS LYS A . n A 1 26 GLU 26 14 14 GLU GLU A . n A 1 27 MSE 27 15 15 MSE MSE A . n A 1 28 TYR 28 16 16 TYR TYR A . n A 1 29 PHE 29 17 17 PHE PHE A . n A 1 30 GLU 30 18 18 GLU GLU A . n A 1 31 LYS 31 19 19 LYS LYS A . n A 1 32 ASP 32 20 20 ASP ASP A . n A 1 33 SER 33 21 21 SER SER A . n A 1 34 GLN 34 22 22 GLN GLN A . n A 1 35 ARG 35 23 23 ARG ARG A . n A 1 36 GLY 36 24 24 GLY GLY A . n A 1 37 ILE 37 25 25 ILE ILE A . n A 1 38 TYR 38 26 26 TYR TYR A . n A 1 39 ALA 39 27 27 ALA ALA A . n A 1 40 THR 40 28 28 THR THR A . n A 1 41 PHE 41 29 29 PHE PHE A . n A 1 42 THR 42 30 30 THR THR A . n A 1 43 TRP 43 31 31 TRP TRP A . n A 1 44 LEU 44 32 32 LEU LEU A . n A 1 45 VAL 45 33 33 VAL VAL A . n A 1 46 GLU 46 34 34 GLU GLU A . n A 1 47 GLU 47 35 35 GLU GLU A . n A 1 48 VAL 48 36 36 VAL VAL A . n A 1 49 GLY 49 37 37 GLY GLY A . n A 1 50 GLU 50 38 38 GLU GLU A . n A 1 51 LEU 51 39 39 LEU LEU A . n A 1 52 ALA 52 40 40 ALA ALA A . n A 1 53 GLU 53 41 41 GLU GLU A . n A 1 54 ALA 54 42 42 ALA ALA A . n A 1 55 LEU 55 43 43 LEU LEU A . n A 1 56 LEU 56 44 44 LEU LEU A . n A 1 57 SER 57 45 45 SER SER A . n A 1 58 ASN 58 46 46 ASN ASN A . n A 1 59 ASN 59 47 47 ASN ASN A . n A 1 60 LEU 60 48 48 LEU LEU A . n A 1 61 ASP 61 49 49 ASP ASP A . n A 1 62 SER 62 50 50 SER SER A . n A 1 63 ILE 63 51 51 ILE ILE A . n A 1 64 GLN 64 52 52 GLN GLN A . n A 1 65 GLU 65 53 53 GLU GLU A . n A 1 66 GLU 66 54 54 GLU GLU A . n A 1 67 LEU 67 55 55 LEU LEU A . n A 1 68 ALA 68 56 56 ALA ALA A . n A 1 69 ASP 69 57 57 ASP ASP A . n A 1 70 VAL 70 58 58 VAL VAL A . n A 1 71 ILE 71 59 59 ILE ILE A . n A 1 72 ALA 72 60 60 ALA ALA A . n A 1 73 TRP 73 61 61 TRP TRP A . n A 1 74 THR 74 62 62 THR THR A . n A 1 75 VAL 75 63 63 VAL VAL A . n A 1 76 SER 76 64 64 SER SER A . n A 1 77 ILE 77 65 65 ILE ILE A . n A 1 78 ALA 78 66 66 ALA ALA A . n A 1 79 ASN 79 67 67 ASN ASN A . n A 1 80 LEU 80 68 68 LEU LEU A . n A 1 81 GLU 81 69 69 GLU GLU A . n A 1 82 GLY 82 70 70 GLY GLY A . n A 1 83 ILE 83 71 71 ILE ILE A . n A 1 84 ASP 84 72 72 ASP ASP A . n A 1 85 ILE 85 73 73 ILE ILE A . n A 1 86 GLU 86 74 74 GLU GLU A . n A 1 87 GLU 87 75 75 GLU GLU A . n A 1 88 ALA 88 76 76 ALA ALA A . n A 1 89 LEU 89 77 77 LEU LEU A . n A 1 90 LYS 90 78 78 LYS LYS A . n A 1 91 LYS 91 79 79 LYS LYS A . n A 1 92 LYS 92 80 80 LYS LYS A . n A 1 93 TYR 93 81 81 TYR TYR A . n A 1 94 LYS 94 82 82 LYS LYS A . n A 1 95 LEU 95 83 83 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 LI 1 84 1 LI LI A . C 3 UNL 1 85 2 UNL UNL A . D 4 HOH 1 86 3 HOH HOH A . D 4 HOH 2 87 4 HOH HOH A . D 4 HOH 3 88 5 HOH HOH A . D 4 HOH 4 89 6 HOH HOH A . D 4 HOH 5 90 7 HOH HOH A . D 4 HOH 6 91 8 HOH HOH A . D 4 HOH 7 92 9 HOH HOH A . D 4 HOH 8 93 10 HOH HOH A . D 4 HOH 9 94 11 HOH HOH A . D 4 HOH 10 95 12 HOH HOH A . D 4 HOH 11 96 13 HOH HOH A . D 4 HOH 12 97 14 HOH HOH A . D 4 HOH 13 98 15 HOH HOH A . D 4 HOH 14 99 16 HOH HOH A . D 4 HOH 15 100 17 HOH HOH A . D 4 HOH 16 101 18 HOH HOH A . D 4 HOH 17 102 19 HOH HOH A . D 4 HOH 18 103 20 HOH HOH A . D 4 HOH 19 104 21 HOH HOH A . D 4 HOH 20 105 22 HOH HOH A . D 4 HOH 21 106 23 HOH HOH A . D 4 HOH 22 107 24 HOH HOH A . D 4 HOH 23 108 25 HOH HOH A . D 4 HOH 24 109 26 HOH HOH A . D 4 HOH 25 110 27 HOH HOH A . D 4 HOH 26 111 28 HOH HOH A . D 4 HOH 27 112 29 HOH HOH A . D 4 HOH 28 113 30 HOH HOH A . D 4 HOH 29 114 31 HOH HOH A . D 4 HOH 30 115 32 HOH HOH A . D 4 HOH 31 116 33 HOH HOH A . D 4 HOH 32 117 34 HOH HOH A . D 4 HOH 33 118 35 HOH HOH A . D 4 HOH 34 119 36 HOH HOH A . D 4 HOH 35 120 37 HOH HOH A . D 4 HOH 36 121 38 HOH HOH A . D 4 HOH 37 122 39 HOH HOH A . D 4 HOH 38 123 40 HOH HOH A . D 4 HOH 39 124 41 HOH HOH A . D 4 HOH 40 125 42 HOH HOH A . D 4 HOH 41 126 43 HOH HOH A . D 4 HOH 42 127 44 HOH HOH A . D 4 HOH 43 128 45 HOH HOH A . D 4 HOH 44 129 46 HOH HOH A . D 4 HOH 45 130 47 HOH HOH A . D 4 HOH 46 131 48 HOH HOH A . D 4 HOH 47 132 49 HOH HOH A . D 4 HOH 48 133 50 HOH HOH A . D 4 HOH 49 134 51 HOH HOH A . D 4 HOH 50 135 52 HOH HOH A . D 4 HOH 51 136 53 HOH HOH A . D 4 HOH 52 137 54 HOH HOH A . D 4 HOH 53 138 55 HOH HOH A . D 4 HOH 54 139 56 HOH HOH A . D 4 HOH 55 140 57 HOH HOH A . D 4 HOH 56 141 58 HOH HOH A . D 4 HOH 57 142 59 HOH HOH A . D 4 HOH 58 143 60 HOH HOH A . D 4 HOH 59 144 61 HOH HOH A . D 4 HOH 60 145 62 HOH HOH A . D 4 HOH 61 146 63 HOH HOH A . D 4 HOH 62 147 64 HOH HOH A . D 4 HOH 63 148 65 HOH HOH A . D 4 HOH 64 149 66 HOH HOH A . D 4 HOH 65 150 67 HOH HOH A . D 4 HOH 66 151 68 HOH HOH A . D 4 HOH 67 152 69 HOH HOH A . D 4 HOH 68 153 70 HOH HOH A . D 4 HOH 69 154 71 HOH HOH A . D 4 HOH 70 155 72 HOH HOH A . D 4 HOH 71 156 73 HOH HOH A . D 4 HOH 72 157 74 HOH HOH A . D 4 HOH 73 158 75 HOH HOH A . D 4 HOH 74 159 76 HOH HOH A . D 4 HOH 75 160 77 HOH HOH A . D 4 HOH 76 161 78 HOH HOH A . D 4 HOH 77 162 79 HOH HOH A . D 4 HOH 78 163 80 HOH HOH A . D 4 HOH 79 164 81 HOH HOH A . D 4 HOH 80 165 82 HOH HOH A . D 4 HOH 81 166 83 HOH HOH A . D 4 HOH 82 167 84 HOH HOH A . D 4 HOH 83 168 85 HOH HOH A . D 4 HOH 84 169 86 HOH HOH A . D 4 HOH 85 170 87 HOH HOH A . D 4 HOH 86 171 88 HOH HOH A . D 4 HOH 87 172 89 HOH HOH A . D 4 HOH 88 173 90 HOH HOH A . D 4 HOH 89 174 91 HOH HOH A . D 4 HOH 90 175 92 HOH HOH A . D 4 HOH 91 176 93 HOH HOH A . D 4 HOH 92 177 94 HOH HOH A . D 4 HOH 93 178 95 HOH HOH A . D 4 HOH 94 179 96 HOH HOH A . D 4 HOH 95 180 97 HOH HOH A . D 4 HOH 96 181 98 HOH HOH A . D 4 HOH 97 182 99 HOH HOH A . D 4 HOH 98 183 100 HOH HOH A . D 4 HOH 99 184 101 HOH HOH A . D 4 HOH 100 185 102 HOH HOH A . D 4 HOH 101 186 103 HOH HOH A . D 4 HOH 102 187 104 HOH HOH A . D 4 HOH 103 188 105 HOH HOH A . D 4 HOH 104 189 106 HOH HOH A . D 4 HOH 105 190 107 HOH HOH A . D 4 HOH 106 191 108 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MSE 1 ? CG ? A MSE 13 CG 2 1 Y 1 A MSE 1 ? CE ? A MSE 13 CE 3 1 Y 1 A GLU 7 ? CD ? A GLU 19 CD 4 1 Y 1 A GLU 7 ? OE1 ? A GLU 19 OE1 5 1 Y 1 A GLU 7 ? OE2 ? A GLU 19 OE2 6 1 Y 1 A GLU 18 ? CD ? A GLU 30 CD 7 1 Y 1 A GLU 18 ? OE1 ? A GLU 30 OE1 8 1 Y 1 A GLU 18 ? OE2 ? A GLU 30 OE2 9 1 Y 1 A LYS 19 ? CD ? A LYS 31 CD 10 1 Y 1 A LYS 19 ? CE ? A LYS 31 CE 11 1 Y 1 A LYS 19 ? NZ ? A LYS 31 NZ 12 1 Y 1 A GLN 22 ? CD ? A GLN 34 CD 13 1 Y 1 A GLN 22 ? OE1 ? A GLN 34 OE1 14 1 Y 1 A GLN 22 ? NE2 ? A GLN 34 NE2 15 1 Y 1 A LYS 82 ? CD ? A LYS 94 CD 16 1 Y 1 A LYS 82 ? CE ? A LYS 94 CE 17 1 Y 1 A LYS 82 ? NZ ? A LYS 94 NZ # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data scaling' . ? 1 SCALA 'data scaling' '4.2)' ? 2 SHELX 'model building' . ? 3 autoSHARP phasing . ? 4 REFMAC refinement '(5.2.0005)' ? 5 XDS 'data reduction' . ? 6 CCP4 'data scaling' '(SCALA)' ? 7 SHELX phasing . ? 8 # _cell.entry_id 1VMG _cell.length_a 79.749 _cell.length_b 79.749 _cell.length_c 95.909 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VMG _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1VMG _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 62.40 _exptl_crystal.density_Matthews 3.30 _exptl_crystal.description ? _exptl_crystal.density_meas ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION,SITTING DROP,NANODROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '1.5M Li2SO4, 0.1M HEPES pH 7.5, VAPOR DIFFUSION,SITTING DROP,NANODROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ADSC _diffrn_detector.details ? _diffrn_detector.pdbx_collection_date 2004-09-18 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double Crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.979834 1.0 2 0.979694 1.0 3 1.020035 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.pdbx_wavelength 0.979834 _diffrn_source.pdbx_wavelength_list 0.979834,0.979694,1.020035 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.entry_id 1VMG _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 1.460 _reflns.d_resolution_low 25.62 _reflns.number_obs 25360 _reflns.percent_possible_obs 93.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_netI_over_sigmaI 19.6 _reflns.B_iso_Wilson_estimate 23.08 _reflns.pdbx_redundancy 5.9 _reflns.pdbx_Rsym_value 0.044 _reflns.number_all ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.46 _reflns_shell.d_res_low 1.54 _reflns_shell.percent_possible_all 57.6 _reflns_shell.pdbx_Rsym_value 0.435 _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.number_unique_all 2241 _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.Rmerge_I_obs ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1VMG _refine.ls_d_res_high 1.46 _refine.ls_d_res_low 25.62 _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_obs 24059 _refine.ls_number_reflns_R_free 1288 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_percent_reflns_obs 93.34 _refine.ls_R_factor_obs 0.14201 _refine.ls_R_factor_R_work 0.14178 _refine.ls_R_factor_R_free 0.14633 _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.B_iso_mean 14.062 _refine.aniso_B[1][1] -0.19 _refine.aniso_B[2][2] -0.19 _refine.aniso_B[3][3] 0.38 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 2. AN UNKNOWN ENTITY BETWEEN TYR 16 AND TRP 61 WAS AS UNK, UNKNOWN LIGAND. THE DENSITY LOOKS SIMILAR TO A GUANINE BASE. 3. THERE ARE ADDITIONAL UNEXPLAINED DENSITIES NEAR ARG 23, TRP 31, TRP 61. IT MAY BE RELATED TO UNK, HOWEVER, DENSITY IS TOO FRAGMENTED TO IDENTIFY OR MODEL. 4. A LI ION WAS TENATIVELY MODELLED ACCORDING TO THE ENVIROMENT. AND ITS PRESENCE IN THE CRYSTALLIZATION BUFFER. ; _refine.pdbx_overall_ESU_R 0.043 _refine.pdbx_overall_ESU_R_Free 0.041 _refine.overall_SU_ML 0.027 _refine.overall_SU_B 1.453 _refine.correlation_coeff_Fo_to_Fc 0.976 _refine.correlation_coeff_Fo_to_Fc_free 0.975 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.ls_R_factor_all ? _refine.ls_number_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 655 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 771 _refine_hist.d_res_high 1.46 _refine_hist.d_res_low 25.62 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 715 0.012 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 695 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 971 1.235 1.988 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 1625 0.800 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 82 4.933 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33 35.014 27.273 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 152 12.092 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 1 14.745 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 125 0.076 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 741 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 118 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 171 0.253 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 624 0.149 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 387 0.084 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 77 0.381 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 8 0.115 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 59 0.133 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 25 0.177 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 444 1.903 3.000 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 171 0.318 3.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 708 2.371 5.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 320 4.279 8.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 263 5.367 11.000 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 360 0.183 0.200 ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 3 0.204 0.200 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.460 _refine_ls_shell.d_res_low 1.498 _refine_ls_shell.percent_reflns_obs 35.07 _refine_ls_shell.number_reflns_R_work 656 _refine_ls_shell.R_factor_R_work 0.256 _refine_ls_shell.percent_reflns_R_free 5.34 _refine_ls_shell.number_reflns_R_free 37 _refine_ls_shell.R_factor_R_free 0.276 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1VMG _struct.title 'Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VMG _struct_keywords.text ;13816655, MazG nucleotide pyrophosphohydrolase, Structural Genomics, JCSG, Protein Structure Initiative, PSI, Joint Center for Structural Genomics, Hydrolase ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q97U11_SULSO _struct_ref.pdbx_db_accession Q97U11 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDLELKELQSKMKEMYFEKDSQRGIYATFTWLVEEVGELAEALLSNNLDSIQEELADVIAWTVSIANLEGIDIEEALKKK YKL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VMG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q97U11 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -11 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1VMG GLY A 2 ? UNP Q97U11 ? ? 'cloning artifact' -10 1 1 1VMG SER A 3 ? UNP Q97U11 ? ? 'cloning artifact' -9 2 1 1VMG ASP A 4 ? UNP Q97U11 ? ? 'cloning artifact' -8 3 1 1VMG LYS A 5 ? UNP Q97U11 ? ? 'cloning artifact' -7 4 1 1VMG ILE A 6 ? UNP Q97U11 ? ? 'cloning artifact' -6 5 1 1VMG HIS A 7 ? UNP Q97U11 ? ? 'cloning artifact' -5 6 1 1VMG HIS A 8 ? UNP Q97U11 ? ? 'cloning artifact' -4 7 1 1VMG HIS A 9 ? UNP Q97U11 ? ? 'cloning artifact' -3 8 1 1VMG HIS A 10 ? UNP Q97U11 ? ? 'cloning artifact' -2 9 1 1VMG HIS A 11 ? UNP Q97U11 ? ? 'cloning artifact' -1 10 1 1VMG HIS A 12 ? UNP Q97U11 ? ? 'cloning artifact' 0 11 1 1VMG MSE A 13 ? UNP Q97U11 MET 1 'modified residue' 1 12 1 1VMG MSE A 24 ? UNP Q97U11 MET 12 'modified residue' 12 13 1 1VMG MSE A 27 ? UNP Q97U11 MET 15 'modified residue' 15 14 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA,PQS tetrameric 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5530 ? 1 MORE -47 ? 1 'SSA (A^2)' 7710 ? 2 'ABSA (A^2)' 13600 ? 2 MORE -126 ? 2 'SSA (A^2)' 12880 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D 2 1,2,3,4 A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z 0.0000000000 -1.0000000000 0.0000000000 79.7490000000 -1.0000000000 0.0000000000 0.0000000000 79.7490000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 159.4980000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_645 y+1,x-1,-z 0.0000000000 1.0000000000 0.0000000000 79.7490000000 1.0000000000 0.0000000000 0.0000000000 -79.7490000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 16 ? GLY A 36 ? GLU A 4 GLY A 24 1 ? 21 HELX_P HELX_P2 2 GLY A 36 ? ASN A 58 ? GLY A 24 ASN A 46 1 ? 23 HELX_P HELX_P3 3 ASN A 59 ? GLY A 82 ? ASN A 47 GLY A 70 1 ? 24 HELX_P HELX_P4 4 ASP A 84 ? TYR A 93 ? ASP A 72 TYR A 81 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 13 C ? ? ? 1_555 A ASP 14 N ? ? A MSE 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale2 covale both ? A LYS 23 C ? ? ? 1_555 A MSE 24 N ? ? A LYS 11 A MSE 12 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale3 covale both ? A MSE 24 C ? ? ? 1_555 A LYS 25 N ? ? A MSE 12 A LYS 13 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A GLU 26 C ? ? ? 1_555 A MSE 27 N ? ? A GLU 14 A MSE 15 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale5 covale both ? A MSE 27 C ? ? ? 1_555 A TYR 28 N ? ? A MSE 15 A TYR 16 1_555 ? ? ? ? ? ? ? 1.332 ? ? metalc1 metalc ? ? A GLU 47 OE1 ? ? ? 1_555 B LI . LI ? ? A GLU 35 A LI 84 1_555 ? ? ? ? ? ? ? 1.901 ? ? metalc2 metalc ? ? A GLU 66 OE1 ? ? ? 1_555 B LI . LI ? ? A GLU 54 A LI 84 1_555 ? ? ? ? ? ? ? 1.988 ? ? metalc3 metalc ? ? A ASP 69 OD2 ? ? ? 1_555 B LI . LI ? ? A ASP 57 A LI 84 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc4 metalc ? ? B LI . LI ? ? ? 1_555 D HOH . O ? ? A LI 84 A HOH 108 1_555 ? ? ? ? ? ? ? 1.674 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 47 ? A GLU 35 ? 1_555 LI ? B LI . ? A LI 84 ? 1_555 OE1 ? A GLU 66 ? A GLU 54 ? 1_555 103.2 ? 2 OE1 ? A GLU 47 ? A GLU 35 ? 1_555 LI ? B LI . ? A LI 84 ? 1_555 OD2 ? A ASP 69 ? A ASP 57 ? 1_555 100.8 ? 3 OE1 ? A GLU 66 ? A GLU 54 ? 1_555 LI ? B LI . ? A LI 84 ? 1_555 OD2 ? A ASP 69 ? A ASP 57 ? 1_555 101.7 ? 4 OE1 ? A GLU 47 ? A GLU 35 ? 1_555 LI ? B LI . ? A LI 84 ? 1_555 O ? D HOH . ? A HOH 108 ? 1_555 121.1 ? 5 OE1 ? A GLU 66 ? A GLU 54 ? 1_555 LI ? B LI . ? A LI 84 ? 1_555 O ? D HOH . ? A HOH 108 ? 1_555 117.2 ? 6 OD2 ? A ASP 69 ? A ASP 57 ? 1_555 LI ? B LI . ? A LI 84 ? 1_555 O ? D HOH . ? A HOH 108 ? 1_555 110.0 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 13 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 24 ? . . . . MSE A 12 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 27 ? . . . . MSE A 15 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A LI 84 ? 4 'BINDING SITE FOR RESIDUE LI A 84' AC2 Software A UNL 85 ? 9 'BINDING SITE FOR RESIDUE UNL A 85' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 47 ? GLU A 35 . ? 1_555 ? 2 AC1 4 GLU A 66 ? GLU A 54 . ? 1_555 ? 3 AC1 4 ASP A 69 ? ASP A 57 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 108 . ? 1_555 ? 5 AC2 9 TYR A 28 ? TYR A 16 . ? 1_555 ? 6 AC2 9 ASP A 32 ? ASP A 20 . ? 1_555 ? 7 AC2 9 ARG A 35 ? ARG A 23 . ? 1_555 ? 8 AC2 9 ALA A 72 ? ALA A 60 . ? 1_555 ? 9 AC2 9 TRP A 73 ? TRP A 61 . ? 1_555 ? 10 AC2 9 SER A 76 ? SER A 64 . ? 1_555 ? 11 AC2 9 TYR A 93 ? TYR A 81 . ? 8_665 ? 12 AC2 9 HOH D . ? HOH A 88 . ? 1_555 ? 13 AC2 9 HOH D . ? HOH A 175 . ? 1_555 ? # _pdbx_entry_details.entry_id 1VMG _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 129 ? ? O A HOH 173 ? ? 2.10 2 1 OE1 A GLU 34 ? B O A HOH 145 ? ? 2.15 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 13 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 24 A MSE 12 ? MET SELENOMETHIONINE 3 A MSE 27 A MSE 15 ? MET SELENOMETHIONINE # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 92 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details . _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 68.5390 _pdbx_refine_tls.origin_y 7.8450 _pdbx_refine_tls.origin_z 3.9150 _pdbx_refine_tls.T[1][1] -0.0081 _pdbx_refine_tls.T[2][2] -0.0199 _pdbx_refine_tls.T[3][3] -0.0211 _pdbx_refine_tls.T[1][2] 0.0004 _pdbx_refine_tls.T[1][3] -0.0002 _pdbx_refine_tls.T[2][3] -0.0041 _pdbx_refine_tls.L[1][1] 0.4738 _pdbx_refine_tls.L[2][2] 0.7849 _pdbx_refine_tls.L[3][3] 0.5075 _pdbx_refine_tls.L[1][2] -0.2119 _pdbx_refine_tls.L[1][3] 0.0800 _pdbx_refine_tls.L[2][3] 0.3208 _pdbx_refine_tls.S[1][1] 0.0045 _pdbx_refine_tls.S[2][2] -0.0261 _pdbx_refine_tls.S[3][3] 0.0216 _pdbx_refine_tls.S[1][2] 0.0030 _pdbx_refine_tls.S[1][3] -0.0257 _pdbx_refine_tls.S[2][3] 0.0546 _pdbx_refine_tls.S[2][1] 0.0682 _pdbx_refine_tls.S[3][1] -0.0086 _pdbx_refine_tls.S[3][2] -0.0386 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 13 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 95 _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 83 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -11 ? A MET 1 2 1 Y 1 A GLY -10 ? A GLY 2 3 1 Y 1 A SER -9 ? A SER 3 4 1 Y 1 A ASP -8 ? A ASP 4 5 1 Y 1 A LYS -7 ? A LYS 5 6 1 Y 1 A ILE -6 ? A ILE 6 7 1 Y 1 A HIS -5 ? A HIS 7 8 1 Y 1 A HIS -4 ? A HIS 8 9 1 Y 1 A HIS -3 ? A HIS 9 10 1 Y 1 A HIS -2 ? A HIS 10 11 1 Y 1 A HIS -1 ? A HIS 11 12 1 Y 1 A HIS 0 ? A HIS 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LI LI LI N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 MSE N N N N 237 MSE CA C N S 238 MSE C C N N 239 MSE O O N N 240 MSE OXT O N N 241 MSE CB C N N 242 MSE CG C N N 243 MSE SE SE N N 244 MSE CE C N N 245 MSE H H N N 246 MSE H2 H N N 247 MSE HA H N N 248 MSE HXT H N N 249 MSE HB2 H N N 250 MSE HB3 H N N 251 MSE HG2 H N N 252 MSE HG3 H N N 253 MSE HE1 H N N 254 MSE HE2 H N N 255 MSE HE3 H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 SER N N N N 280 SER CA C N S 281 SER C C N N 282 SER O O N N 283 SER CB C N N 284 SER OG O N N 285 SER OXT O N N 286 SER H H N N 287 SER H2 H N N 288 SER HA H N N 289 SER HB2 H N N 290 SER HB3 H N N 291 SER HG H N N 292 SER HXT H N N 293 THR N N N N 294 THR CA C N S 295 THR C C N N 296 THR O O N N 297 THR CB C N R 298 THR OG1 O N N 299 THR CG2 C N N 300 THR OXT O N N 301 THR H H N N 302 THR H2 H N N 303 THR HA H N N 304 THR HB H N N 305 THR HG1 H N N 306 THR HG21 H N N 307 THR HG22 H N N 308 THR HG23 H N N 309 THR HXT H N N 310 TRP N N N N 311 TRP CA C N S 312 TRP C C N N 313 TRP O O N N 314 TRP CB C N N 315 TRP CG C Y N 316 TRP CD1 C Y N 317 TRP CD2 C Y N 318 TRP NE1 N Y N 319 TRP CE2 C Y N 320 TRP CE3 C Y N 321 TRP CZ2 C Y N 322 TRP CZ3 C Y N 323 TRP CH2 C Y N 324 TRP OXT O N N 325 TRP H H N N 326 TRP H2 H N N 327 TRP HA H N N 328 TRP HB2 H N N 329 TRP HB3 H N N 330 TRP HD1 H N N 331 TRP HE1 H N N 332 TRP HE3 H N N 333 TRP HZ2 H N N 334 TRP HZ3 H N N 335 TRP HH2 H N N 336 TRP HXT H N N 337 TYR N N N N 338 TYR CA C N S 339 TYR C C N N 340 TYR O O N N 341 TYR CB C N N 342 TYR CG C Y N 343 TYR CD1 C Y N 344 TYR CD2 C Y N 345 TYR CE1 C Y N 346 TYR CE2 C Y N 347 TYR CZ C Y N 348 TYR OH O N N 349 TYR OXT O N N 350 TYR H H N N 351 TYR H2 H N N 352 TYR HA H N N 353 TYR HB2 H N N 354 TYR HB3 H N N 355 TYR HD1 H N N 356 TYR HD2 H N N 357 TYR HE1 H N N 358 TYR HE2 H N N 359 TYR HH H N N 360 TYR HXT H N N 361 VAL N N N N 362 VAL CA C N S 363 VAL C C N N 364 VAL O O N N 365 VAL CB C N N 366 VAL CG1 C N N 367 VAL CG2 C N N 368 VAL OXT O N N 369 VAL H H N N 370 VAL H2 H N N 371 VAL HA H N N 372 VAL HB H N N 373 VAL HG11 H N N 374 VAL HG12 H N N 375 VAL HG13 H N N 376 VAL HG21 H N N 377 VAL HG22 H N N 378 VAL HG23 H N N 379 VAL HXT H N N 380 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 MSE N CA sing N N 224 MSE N H sing N N 225 MSE N H2 sing N N 226 MSE CA C sing N N 227 MSE CA CB sing N N 228 MSE CA HA sing N N 229 MSE C O doub N N 230 MSE C OXT sing N N 231 MSE OXT HXT sing N N 232 MSE CB CG sing N N 233 MSE CB HB2 sing N N 234 MSE CB HB3 sing N N 235 MSE CG SE sing N N 236 MSE CG HG2 sing N N 237 MSE CG HG3 sing N N 238 MSE SE CE sing N N 239 MSE CE HE1 sing N N 240 MSE CE HE2 sing N N 241 MSE CE HE3 sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 SER N CA sing N N 266 SER N H sing N N 267 SER N H2 sing N N 268 SER CA C sing N N 269 SER CA CB sing N N 270 SER CA HA sing N N 271 SER C O doub N N 272 SER C OXT sing N N 273 SER CB OG sing N N 274 SER CB HB2 sing N N 275 SER CB HB3 sing N N 276 SER OG HG sing N N 277 SER OXT HXT sing N N 278 THR N CA sing N N 279 THR N H sing N N 280 THR N H2 sing N N 281 THR CA C sing N N 282 THR CA CB sing N N 283 THR CA HA sing N N 284 THR C O doub N N 285 THR C OXT sing N N 286 THR CB OG1 sing N N 287 THR CB CG2 sing N N 288 THR CB HB sing N N 289 THR OG1 HG1 sing N N 290 THR CG2 HG21 sing N N 291 THR CG2 HG22 sing N N 292 THR CG2 HG23 sing N N 293 THR OXT HXT sing N N 294 TRP N CA sing N N 295 TRP N H sing N N 296 TRP N H2 sing N N 297 TRP CA C sing N N 298 TRP CA CB sing N N 299 TRP CA HA sing N N 300 TRP C O doub N N 301 TRP C OXT sing N N 302 TRP CB CG sing N N 303 TRP CB HB2 sing N N 304 TRP CB HB3 sing N N 305 TRP CG CD1 doub Y N 306 TRP CG CD2 sing Y N 307 TRP CD1 NE1 sing Y N 308 TRP CD1 HD1 sing N N 309 TRP CD2 CE2 doub Y N 310 TRP CD2 CE3 sing Y N 311 TRP NE1 CE2 sing Y N 312 TRP NE1 HE1 sing N N 313 TRP CE2 CZ2 sing Y N 314 TRP CE3 CZ3 doub Y N 315 TRP CE3 HE3 sing N N 316 TRP CZ2 CH2 doub Y N 317 TRP CZ2 HZ2 sing N N 318 TRP CZ3 CH2 sing Y N 319 TRP CZ3 HZ3 sing N N 320 TRP CH2 HH2 sing N N 321 TRP OXT HXT sing N N 322 TYR N CA sing N N 323 TYR N H sing N N 324 TYR N H2 sing N N 325 TYR CA C sing N N 326 TYR CA CB sing N N 327 TYR CA HA sing N N 328 TYR C O doub N N 329 TYR C OXT sing N N 330 TYR CB CG sing N N 331 TYR CB HB2 sing N N 332 TYR CB HB3 sing N N 333 TYR CG CD1 doub Y N 334 TYR CG CD2 sing Y N 335 TYR CD1 CE1 sing Y N 336 TYR CD1 HD1 sing N N 337 TYR CD2 CE2 doub Y N 338 TYR CD2 HD2 sing N N 339 TYR CE1 CZ doub Y N 340 TYR CE1 HE1 sing N N 341 TYR CE2 CZ sing Y N 342 TYR CE2 HE2 sing N N 343 TYR CZ OH sing N N 344 TYR OH HH sing N N 345 TYR OXT HXT sing N N 346 VAL N CA sing N N 347 VAL N H sing N N 348 VAL N H2 sing N N 349 VAL CA C sing N N 350 VAL CA CB sing N N 351 VAL CA HA sing N N 352 VAL C O doub N N 353 VAL C OXT sing N N 354 VAL CB CG1 sing N N 355 VAL CB CG2 sing N N 356 VAL CB HB sing N N 357 VAL CG1 HG11 sing N N 358 VAL CG1 HG12 sing N N 359 VAL CG1 HG13 sing N N 360 VAL CG2 HG21 sing N N 361 VAL CG2 HG22 sing N N 362 VAL CG2 HG23 sing N N 363 VAL OXT HXT sing N N 364 # _atom_sites.entry_id 1VMG _atom_sites.fract_transf_matrix[1][1] 0.012539 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012539 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010427 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C LI N O SE # loop_