data_1VMJ # _entry.id 1VMJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VMJ pdb_00001vmj 10.2210/pdb1vmj/pdb RCSB RCSB002015 ? ? WWPDB D_1000002015 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 282593 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 1VMJ _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2004-09-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of hypothetical protein (TM0723) from Thermotoga maritima at 1.52 A resolution' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.length_a 110.194 _cell.length_b 110.194 _cell.length_c 110.194 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.entry_id 1VMJ _cell.pdbx_unique_axis ? _cell.Z_PDB 24 # _symmetry.space_group_name_H-M 'P 43 3 2' _symmetry.entry_id 1VMJ _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 212 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein TM0723' 17817.424 1 ? ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 213 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSDKIHHHHHHMKSYRKELWFHTKRRREFINITPLLEECVRESGIKEGLLLCNAMHITASVFINDDEPGLHHDFEVWLE KLAPEKPYSQYKHNDTGEDNADAHLKRTIMGREVVIAITDRKMDLGPWEQVFYGEFDGMRPKRVLVKIIGE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSDKIHHHHHHMKSYRKELWFHTKRRREFINITPLLEECVRESGIKEGLLLCNAMHITASVFINDDEPGLHHDFEVWLE KLAPEKPYSQYKHNDTGEDNADAHLKRTIMGREVVIAITDRKMDLGPWEQVFYGEFDGMRPKRVLVKIIGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 282593 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 ASP n 1 5 LYS n 1 6 ILE n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 MET n 1 14 LYS n 1 15 SER n 1 16 TYR n 1 17 ARG n 1 18 LYS n 1 19 GLU n 1 20 LEU n 1 21 TRP n 1 22 PHE n 1 23 HIS n 1 24 THR n 1 25 LYS n 1 26 ARG n 1 27 ARG n 1 28 ARG n 1 29 GLU n 1 30 PHE n 1 31 ILE n 1 32 ASN n 1 33 ILE n 1 34 THR n 1 35 PRO n 1 36 LEU n 1 37 LEU n 1 38 GLU n 1 39 GLU n 1 40 CYS n 1 41 VAL n 1 42 ARG n 1 43 GLU n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 LYS n 1 48 GLU n 1 49 GLY n 1 50 LEU n 1 51 LEU n 1 52 LEU n 1 53 CYS n 1 54 ASN n 1 55 ALA n 1 56 MET n 1 57 HIS n 1 58 ILE n 1 59 THR n 1 60 ALA n 1 61 SER n 1 62 VAL n 1 63 PHE n 1 64 ILE n 1 65 ASN n 1 66 ASP n 1 67 ASP n 1 68 GLU n 1 69 PRO n 1 70 GLY n 1 71 LEU n 1 72 HIS n 1 73 HIS n 1 74 ASP n 1 75 PHE n 1 76 GLU n 1 77 VAL n 1 78 TRP n 1 79 LEU n 1 80 GLU n 1 81 LYS n 1 82 LEU n 1 83 ALA n 1 84 PRO n 1 85 GLU n 1 86 LYS n 1 87 PRO n 1 88 TYR n 1 89 SER n 1 90 GLN n 1 91 TYR n 1 92 LYS n 1 93 HIS n 1 94 ASN n 1 95 ASP n 1 96 THR n 1 97 GLY n 1 98 GLU n 1 99 ASP n 1 100 ASN n 1 101 ALA n 1 102 ASP n 1 103 ALA n 1 104 HIS n 1 105 LEU n 1 106 LYS n 1 107 ARG n 1 108 THR n 1 109 ILE n 1 110 MET n 1 111 GLY n 1 112 ARG n 1 113 GLU n 1 114 VAL n 1 115 VAL n 1 116 ILE n 1 117 ALA n 1 118 ILE n 1 119 THR n 1 120 ASP n 1 121 ARG n 1 122 LYS n 1 123 MET n 1 124 ASP n 1 125 LEU n 1 126 GLY n 1 127 PRO n 1 128 TRP n 1 129 GLU n 1 130 GLN n 1 131 VAL n 1 132 PHE n 1 133 TYR n 1 134 GLY n 1 135 GLU n 1 136 PHE n 1 137 ASP n 1 138 GLY n 1 139 MET n 1 140 ARG n 1 141 PRO n 1 142 LYS n 1 143 ARG n 1 144 VAL n 1 145 LEU n 1 146 VAL n 1 147 LYS n 1 148 ILE n 1 149 ILE n 1 150 GLY n 1 151 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermotoga _entity_src_gen.pdbx_gene_src_gene TM0723 _entity_src_gen.gene_src_species 'Thermotoga maritima' _entity_src_gen.gene_src_strain MSB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9WZI2_THEMA _struct_ref.pdbx_db_accession Q9WZI2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSYRKELWFHTKRRREFINITPLLEECVRESGIKEGLLLCNAMHITASVFINDDEPGLHHDFEVWLEKLAPEKPYSQYK HNDTGEDNADAHLKRTIMGREVVIAITDRKMDLGPWEQVFYGEFDGMRPKRVLVKIIGE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VMJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WZI2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1VMJ MET A 1 ? UNP Q9WZI2 ? ? 'expression tag' -11 1 1 1VMJ GLY A 2 ? UNP Q9WZI2 ? ? 'expression tag' -10 2 1 1VMJ SER A 3 ? UNP Q9WZI2 ? ? 'expression tag' -9 3 1 1VMJ ASP A 4 ? UNP Q9WZI2 ? ? 'expression tag' -8 4 1 1VMJ LYS A 5 ? UNP Q9WZI2 ? ? 'expression tag' -7 5 1 1VMJ ILE A 6 ? UNP Q9WZI2 ? ? 'expression tag' -6 6 1 1VMJ HIS A 7 ? UNP Q9WZI2 ? ? 'expression tag' -5 7 1 1VMJ HIS A 8 ? UNP Q9WZI2 ? ? 'expression tag' -4 8 1 1VMJ HIS A 9 ? UNP Q9WZI2 ? ? 'expression tag' -3 9 1 1VMJ HIS A 10 ? UNP Q9WZI2 ? ? 'expression tag' -2 10 1 1VMJ HIS A 11 ? UNP Q9WZI2 ? ? 'expression tag' -1 11 1 1VMJ HIS A 12 ? UNP Q9WZI2 ? ? 'expression tag' 0 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 1VMJ # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 56.48 _exptl_crystal.density_Matthews 2.85 _exptl_crystal.description ? _exptl_crystal.density_meas ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION,SITTING DROP,NANODROP' _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '3.2M (NH4)2SO4, 0.1M MES pH 6.0, VAPOR DIFFUSION,SITTING DROP,NANODROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.details 'flat mirror' _diffrn_detector.pdbx_collection_date 2001-12-09 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'single crystal Si(311) bent monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.024627 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline BL11-1 _diffrn_source.type 'SSRL BEAMLINE BL11-1' _diffrn_source.pdbx_wavelength 1.024627 _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_wavelength_list ? # _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 1.520 _reflns.d_resolution_low 27.55 _reflns.number_obs 35764 _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_netI_over_sigmaI 19.2 _reflns.B_iso_Wilson_estimate 24.03 _reflns.pdbx_redundancy 20.5 _reflns.pdbx_Rsym_value 0.115 _reflns.entry_id 1VMJ _reflns.number_all ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.52 _reflns_shell.d_res_low 1.60 _reflns_shell.percent_possible_all 100.0 _reflns_shell.pdbx_Rsym_value 0.01166 _reflns_shell.pdbx_redundancy 8.8 _reflns_shell.number_unique_all 5117 _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.ls_d_res_high 1.52 _refine.ls_d_res_low 27.55 _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_obs 33973 _refine.ls_number_reflns_R_free 1790 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_percent_reflns_obs 99.94 _refine.ls_R_factor_obs 0.14495 _refine.ls_R_factor_R_work 0.144 _refine.ls_R_factor_R_free 0.16302 _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1VMF _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.B_iso_mean 15.684 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. THE DENSITY FOR SO4 4 IS LOCATED ON CRYSTALLOGRAPHIC 2-FOLD AXIS. THERE ARE SOME EXTRA DIFFERENCE DENSITY AFTER THE MODELLING OF 1/2 OCCUPIED SULFATE. ; _refine.pdbx_overall_ESU_R 0.049 _refine.pdbx_overall_ESU_R_Free 0.051 _refine.overall_SU_ML 0.036 _refine.overall_SU_B 1.965 _refine.correlation_coeff_Fo_to_Fc 0.976 _refine.correlation_coeff_Fo_to_Fc_free 0.972 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.entry_id 1VMJ _refine.ls_R_factor_all ? _refine.ls_number_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1138 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 213 _refine_hist.number_atoms_total 1367 _refine_hist.d_res_high 1.52 _refine_hist.d_res_low 27.55 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1209 0.011 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 1104 0.002 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1630 1.358 1.963 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 2566 0.795 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 138 6.717 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 62 38.858 23.226 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 228 11.836 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 11 13.907 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 170 0.084 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1302 0.006 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 254 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 226 0.240 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 1121 0.196 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 729 0.084 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 161 0.166 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 9 0.128 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 65 0.284 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 23 0.144 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 696 1.402 3.000 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 283 0.411 3.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1134 2.277 5.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 531 3.674 8.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 496 5.350 11.000 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 575 0.179 0.200 ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 5 0.266 0.200 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.520 _refine_ls_shell.d_res_low 1.560 _refine_ls_shell.percent_reflns_obs 99.77 _refine_ls_shell.number_reflns_R_work 2460 _refine_ls_shell.R_factor_R_work 0.284 _refine_ls_shell.percent_reflns_R_free 5.24 _refine_ls_shell.number_reflns_R_free 136 _refine_ls_shell.R_factor_R_free 0.314 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1VMJ _struct.title 'CRYSTAL STRUCTURE OF A PUTATIVE THIAMIN PHOSPHATE SYNTHASE (TM0723) FROM THERMOTOGA MARITIMA MSB8 AT 1.52 A RESOLUTION' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;PUTATIVE THIAMIN PHOSPHATE SYNTHASE, STRUCTURAL GENOMICS, JOINT CENTER FOR STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.entry_id 1VMJ # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 33 ? GLY A 45 ? ILE A 21 GLY A 33 1 ? 13 HELX_P HELX_P2 2 GLU A 68 ? ALA A 83 ? GLU A 56 ALA A 71 1 ? 16 HELX_P HELX_P3 3 PRO A 87 ? ASP A 95 ? PRO A 75 ASP A 83 5 ? 9 HELX_P HELX_P4 4 ASN A 100 ? GLY A 111 ? ASN A 88 GLY A 99 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 93 NE2 ? ? ? 1_555 B NA . NA ? ? A HIS 81 A NA 140 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc2 metalc ? ? A ASN 100 OD1 ? ? ? 1_555 B NA . NA ? ? A ASN 88 A NA 140 1_555 ? ? ? ? ? ? ? 2.485 ? ? metalc3 metalc ? ? A HIS 104 NE2 ? ? ? 1_555 B NA . NA ? ? A HIS 92 A NA 140 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc4 metalc ? ? B NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 140 A HOH 199 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc5 metalc ? ? B NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 140 A HOH 208 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc6 metalc ? ? B NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 140 A HOH 256 1_555 ? ? ? ? ? ? ? 2.191 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 74 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 75 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.28 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 14 ? PHE A 22 ? LYS A 2 PHE A 10 A 2 LYS A 142 ? GLU A 151 ? LYS A 130 GLU A 139 A 3 GLU A 48 ? ALA A 55 ? GLU A 36 ALA A 43 A 4 GLU A 113 ? THR A 119 ? GLU A 101 THR A 107 A 5 LYS A 122 ? MET A 123 ? LYS A 110 MET A 111 B 1 GLU A 29 ? ASN A 32 ? GLU A 17 ASN A 20 B 2 GLN A 130 ? GLU A 135 ? GLN A 118 GLU A 123 B 3 ALA A 60 ? ASN A 65 ? ALA A 48 ASN A 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 14 ? N LYS A 2 O GLY A 150 ? O GLY A 138 A 2 3 O LYS A 147 ? O LYS A 135 N LEU A 52 ? N LEU A 40 A 3 4 N LEU A 51 ? N LEU A 39 O ILE A 116 ? O ILE A 104 A 4 5 N THR A 119 ? N THR A 107 O LYS A 122 ? O LYS A 110 B 1 2 N GLU A 29 ? N GLU A 17 O GLU A 135 ? O GLU A 123 B 2 3 O PHE A 132 ? O PHE A 120 N PHE A 63 ? N PHE A 51 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NA 140 ? 6 'BINDING SITE FOR RESIDUE NA A 140' AC2 Software A SO4 141 ? 10 'BINDING SITE FOR RESIDUE SO4 A 141' AC3 Software A SO4 142 ? 11 'BINDING SITE FOR RESIDUE SO4 A 142' AC4 Software A SO4 143 ? 9 'BINDING SITE FOR RESIDUE SO4 A 143' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 93 ? HIS A 81 . ? 1_555 ? 2 AC1 6 ASN A 100 ? ASN A 88 . ? 1_555 ? 3 AC1 6 HIS A 104 ? HIS A 92 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 199 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 208 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 256 . ? 1_555 ? 7 AC2 10 HIS A 57 ? HIS A 45 . ? 1_555 ? 8 AC2 10 ILE A 58 ? ILE A 46 . ? 1_555 ? 9 AC2 10 THR A 59 ? THR A 47 . ? 1_555 ? 10 AC2 10 TRP A 128 ? TRP A 116 . ? 9_555 ? 11 AC2 10 ARG A 140 ? ARG A 128 . ? 1_555 ? 12 AC2 10 HOH F . ? HOH A 157 . ? 1_555 ? 13 AC2 10 HOH F . ? HOH A 238 . ? 9_555 ? 14 AC2 10 HOH F . ? HOH A 256 . ? 1_555 ? 15 AC2 10 HOH F . ? HOH A 279 . ? 1_555 ? 16 AC2 10 HOH F . ? HOH A 303 . ? 1_555 ? 17 AC3 11 LYS A 86 ? LYS A 74 . ? 19_666 ? 18 AC3 11 PRO A 87 ? PRO A 75 . ? 1_555 ? 19 AC3 11 TYR A 88 ? TYR A 76 . ? 1_555 ? 20 AC3 11 SER A 89 ? SER A 77 . ? 1_555 ? 21 AC3 11 HOH F . ? HOH A 167 . ? 19_666 ? 22 AC3 11 HOH F . ? HOH A 167 . ? 1_555 ? 23 AC3 11 HOH F . ? HOH A 198 . ? 1_555 ? 24 AC3 11 HOH F . ? HOH A 237 . ? 1_555 ? 25 AC3 11 HOH F . ? HOH A 255 . ? 1_555 ? 26 AC3 11 HOH F . ? HOH A 255 . ? 19_666 ? 27 AC3 11 HOH F . ? HOH A 289 . ? 1_555 ? 28 AC4 9 LYS A 18 ? LYS A 6 . ? 1_555 ? 29 AC4 9 LYS A 18 ? LYS A 6 . ? 18_554 ? 30 AC4 9 GLU A 19 ? GLU A 7 . ? 1_555 ? 31 AC4 9 GLU A 19 ? GLU A 7 . ? 18_554 ? 32 AC4 9 HOH F . ? HOH A 187 . ? 18_554 ? 33 AC4 9 HOH F . ? HOH A 187 . ? 1_555 ? 34 AC4 9 HOH F . ? HOH A 211 . ? 1_555 ? 35 AC4 9 HOH F . ? HOH A 211 . ? 18_554 ? 36 AC4 9 HOH F . ? HOH A 280 . ? 18_554 ? # _atom_sites.entry_id 1VMJ _atom_sites.fract_transf_matrix[1][1] 0.009075 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009075 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009075 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -11 ? ? ? A . n A 1 2 GLY 2 -10 ? ? ? A . n A 1 3 SER 3 -9 ? ? ? A . n A 1 4 ASP 4 -8 ? ? ? A . n A 1 5 LYS 5 -7 ? ? ? A . n A 1 6 ILE 6 -6 ? ? ? A . n A 1 7 HIS 7 -5 ? ? ? A . n A 1 8 HIS 8 -4 ? ? ? A . n A 1 9 HIS 9 -3 ? ? ? A . n A 1 10 HIS 10 -2 ? ? ? A . n A 1 11 HIS 11 -1 ? ? ? A . n A 1 12 HIS 12 0 ? ? ? A . n A 1 13 MET 13 1 1 MET MET A . n A 1 14 LYS 14 2 2 LYS LYS A . n A 1 15 SER 15 3 3 SER SER A . n A 1 16 TYR 16 4 4 TYR TYR A . n A 1 17 ARG 17 5 5 ARG ARG A . n A 1 18 LYS 18 6 6 LYS LYS A . n A 1 19 GLU 19 7 7 GLU GLU A . n A 1 20 LEU 20 8 8 LEU LEU A . n A 1 21 TRP 21 9 9 TRP TRP A . n A 1 22 PHE 22 10 10 PHE PHE A . n A 1 23 HIS 23 11 11 HIS HIS A . n A 1 24 THR 24 12 12 THR THR A . n A 1 25 LYS 25 13 13 LYS LYS A . n A 1 26 ARG 26 14 14 ARG ARG A . n A 1 27 ARG 27 15 15 ARG ARG A . n A 1 28 ARG 28 16 16 ARG ARG A . n A 1 29 GLU 29 17 17 GLU GLU A . n A 1 30 PHE 30 18 18 PHE PHE A . n A 1 31 ILE 31 19 19 ILE ILE A . n A 1 32 ASN 32 20 20 ASN ASN A . n A 1 33 ILE 33 21 21 ILE ILE A . n A 1 34 THR 34 22 22 THR THR A . n A 1 35 PRO 35 23 23 PRO PRO A . n A 1 36 LEU 36 24 24 LEU LEU A . n A 1 37 LEU 37 25 25 LEU LEU A . n A 1 38 GLU 38 26 26 GLU GLU A . n A 1 39 GLU 39 27 27 GLU GLU A . n A 1 40 CYS 40 28 28 CYS CYS A . n A 1 41 VAL 41 29 29 VAL VAL A . n A 1 42 ARG 42 30 30 ARG ARG A . n A 1 43 GLU 43 31 31 GLU GLU A . n A 1 44 SER 44 32 32 SER SER A . n A 1 45 GLY 45 33 33 GLY GLY A . n A 1 46 ILE 46 34 34 ILE ILE A . n A 1 47 LYS 47 35 35 LYS LYS A . n A 1 48 GLU 48 36 36 GLU GLU A . n A 1 49 GLY 49 37 37 GLY GLY A . n A 1 50 LEU 50 38 38 LEU LEU A . n A 1 51 LEU 51 39 39 LEU LEU A . n A 1 52 LEU 52 40 40 LEU LEU A . n A 1 53 CYS 53 41 41 CYS CYS A . n A 1 54 ASN 54 42 42 ASN ASN A . n A 1 55 ALA 55 43 43 ALA ALA A . n A 1 56 MET 56 44 44 MET MET A . n A 1 57 HIS 57 45 45 HIS HIS A . n A 1 58 ILE 58 46 46 ILE ILE A . n A 1 59 THR 59 47 47 THR THR A . n A 1 60 ALA 60 48 48 ALA ALA A . n A 1 61 SER 61 49 49 SER SER A . n A 1 62 VAL 62 50 50 VAL VAL A . n A 1 63 PHE 63 51 51 PHE PHE A . n A 1 64 ILE 64 52 52 ILE ILE A . n A 1 65 ASN 65 53 53 ASN ASN A . n A 1 66 ASP 66 54 54 ASP ASP A . n A 1 67 ASP 67 55 55 ASP ASP A . n A 1 68 GLU 68 56 56 GLU GLU A . n A 1 69 PRO 69 57 57 PRO PRO A . n A 1 70 GLY 70 58 58 GLY GLY A . n A 1 71 LEU 71 59 59 LEU LEU A . n A 1 72 HIS 72 60 60 HIS HIS A . n A 1 73 HIS 73 61 61 HIS HIS A . n A 1 74 ASP 74 62 62 ASP ASP A . n A 1 75 PHE 75 63 63 PHE PHE A . n A 1 76 GLU 76 64 64 GLU GLU A . n A 1 77 VAL 77 65 65 VAL VAL A . n A 1 78 TRP 78 66 66 TRP TRP A . n A 1 79 LEU 79 67 67 LEU LEU A . n A 1 80 GLU 80 68 68 GLU GLU A . n A 1 81 LYS 81 69 69 LYS LYS A . n A 1 82 LEU 82 70 70 LEU LEU A . n A 1 83 ALA 83 71 71 ALA ALA A . n A 1 84 PRO 84 72 72 PRO PRO A . n A 1 85 GLU 85 73 73 GLU GLU A . n A 1 86 LYS 86 74 74 LYS LYS A . n A 1 87 PRO 87 75 75 PRO PRO A . n A 1 88 TYR 88 76 76 TYR TYR A . n A 1 89 SER 89 77 77 SER SER A . n A 1 90 GLN 90 78 78 GLN GLN A . n A 1 91 TYR 91 79 79 TYR TYR A . n A 1 92 LYS 92 80 80 LYS LYS A . n A 1 93 HIS 93 81 81 HIS HIS A . n A 1 94 ASN 94 82 82 ASN ASN A . n A 1 95 ASP 95 83 83 ASP ASP A . n A 1 96 THR 96 84 84 THR THR A . n A 1 97 GLY 97 85 85 GLY GLY A . n A 1 98 GLU 98 86 86 GLU GLU A . n A 1 99 ASP 99 87 87 ASP ASP A . n A 1 100 ASN 100 88 88 ASN ASN A . n A 1 101 ALA 101 89 89 ALA ALA A . n A 1 102 ASP 102 90 90 ASP ASP A . n A 1 103 ALA 103 91 91 ALA ALA A . n A 1 104 HIS 104 92 92 HIS HIS A . n A 1 105 LEU 105 93 93 LEU LEU A . n A 1 106 LYS 106 94 94 LYS LYS A . n A 1 107 ARG 107 95 95 ARG ARG A . n A 1 108 THR 108 96 96 THR THR A . n A 1 109 ILE 109 97 97 ILE ILE A . n A 1 110 MET 110 98 98 MET MET A . n A 1 111 GLY 111 99 99 GLY GLY A . n A 1 112 ARG 112 100 100 ARG ARG A . n A 1 113 GLU 113 101 101 GLU GLU A . n A 1 114 VAL 114 102 102 VAL VAL A . n A 1 115 VAL 115 103 103 VAL VAL A . n A 1 116 ILE 116 104 104 ILE ILE A . n A 1 117 ALA 117 105 105 ALA ALA A . n A 1 118 ILE 118 106 106 ILE ILE A . n A 1 119 THR 119 107 107 THR THR A . n A 1 120 ASP 120 108 108 ASP ASP A . n A 1 121 ARG 121 109 109 ARG ARG A . n A 1 122 LYS 122 110 110 LYS LYS A . n A 1 123 MET 123 111 111 MET MET A . n A 1 124 ASP 124 112 112 ASP ASP A . n A 1 125 LEU 125 113 113 LEU LEU A . n A 1 126 GLY 126 114 114 GLY GLY A . n A 1 127 PRO 127 115 115 PRO PRO A . n A 1 128 TRP 128 116 116 TRP TRP A . n A 1 129 GLU 129 117 117 GLU GLU A . n A 1 130 GLN 130 118 118 GLN GLN A . n A 1 131 VAL 131 119 119 VAL VAL A . n A 1 132 PHE 132 120 120 PHE PHE A . n A 1 133 TYR 133 121 121 TYR TYR A . n A 1 134 GLY 134 122 122 GLY GLY A . n A 1 135 GLU 135 123 123 GLU GLU A . n A 1 136 PHE 136 124 124 PHE PHE A . n A 1 137 ASP 137 125 125 ASP ASP A . n A 1 138 GLY 138 126 126 GLY GLY A . n A 1 139 MET 139 127 127 MET MET A . n A 1 140 ARG 140 128 128 ARG ARG A . n A 1 141 PRO 141 129 129 PRO PRO A . n A 1 142 LYS 142 130 130 LYS LYS A . n A 1 143 ARG 143 131 131 ARG ARG A . n A 1 144 VAL 144 132 132 VAL VAL A . n A 1 145 LEU 145 133 133 LEU LEU A . n A 1 146 VAL 146 134 134 VAL VAL A . n A 1 147 LYS 147 135 135 LYS LYS A . n A 1 148 ILE 148 136 136 ILE ILE A . n A 1 149 ILE 149 137 137 ILE ILE A . n A 1 150 GLY 150 138 138 GLY GLY A . n A 1 151 GLU 151 139 139 GLU GLU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 140 1 NA NA A . C 3 SO4 1 141 2 SO4 SO4 A . D 3 SO4 1 142 3 SO4 SO4 A . E 3 SO4 1 143 4 SO4 SO4 A . F 4 HOH 1 144 5 HOH HOH A . F 4 HOH 2 145 6 HOH HOH A . F 4 HOH 3 146 7 HOH HOH A . F 4 HOH 4 147 8 HOH HOH A . F 4 HOH 5 148 9 HOH HOH A . F 4 HOH 6 149 10 HOH HOH A . F 4 HOH 7 150 11 HOH HOH A . F 4 HOH 8 151 12 HOH HOH A . F 4 HOH 9 152 13 HOH HOH A . F 4 HOH 10 153 14 HOH HOH A . F 4 HOH 11 154 15 HOH HOH A . F 4 HOH 12 155 16 HOH HOH A . F 4 HOH 13 156 17 HOH HOH A . F 4 HOH 14 157 18 HOH HOH A . F 4 HOH 15 158 19 HOH HOH A . F 4 HOH 16 159 20 HOH HOH A . F 4 HOH 17 160 21 HOH HOH A . F 4 HOH 18 161 22 HOH HOH A . F 4 HOH 19 162 23 HOH HOH A . F 4 HOH 20 163 24 HOH HOH A . F 4 HOH 21 164 25 HOH HOH A . F 4 HOH 22 165 26 HOH HOH A . F 4 HOH 23 166 27 HOH HOH A . F 4 HOH 24 167 28 HOH HOH A . F 4 HOH 25 168 29 HOH HOH A . F 4 HOH 26 169 30 HOH HOH A . F 4 HOH 27 170 31 HOH HOH A . F 4 HOH 28 171 32 HOH HOH A . F 4 HOH 29 172 33 HOH HOH A . F 4 HOH 30 173 34 HOH HOH A . F 4 HOH 31 174 35 HOH HOH A . F 4 HOH 32 175 36 HOH HOH A . F 4 HOH 33 176 37 HOH HOH A . F 4 HOH 34 177 38 HOH HOH A . F 4 HOH 35 178 39 HOH HOH A . F 4 HOH 36 179 40 HOH HOH A . F 4 HOH 37 180 41 HOH HOH A . F 4 HOH 38 181 42 HOH HOH A . F 4 HOH 39 182 43 HOH HOH A . F 4 HOH 40 183 44 HOH HOH A . F 4 HOH 41 184 45 HOH HOH A . F 4 HOH 42 185 46 HOH HOH A . F 4 HOH 43 186 47 HOH HOH A . F 4 HOH 44 187 48 HOH HOH A . F 4 HOH 45 188 49 HOH HOH A . F 4 HOH 46 189 50 HOH HOH A . F 4 HOH 47 190 51 HOH HOH A . F 4 HOH 48 191 52 HOH HOH A . F 4 HOH 49 192 53 HOH HOH A . F 4 HOH 50 193 54 HOH HOH A . F 4 HOH 51 194 55 HOH HOH A . F 4 HOH 52 195 56 HOH HOH A . F 4 HOH 53 196 57 HOH HOH A . F 4 HOH 54 197 58 HOH HOH A . F 4 HOH 55 198 59 HOH HOH A . F 4 HOH 56 199 60 HOH HOH A . F 4 HOH 57 200 61 HOH HOH A . F 4 HOH 58 201 62 HOH HOH A . F 4 HOH 59 202 63 HOH HOH A . F 4 HOH 60 203 64 HOH HOH A . F 4 HOH 61 204 65 HOH HOH A . F 4 HOH 62 205 66 HOH HOH A . F 4 HOH 63 206 67 HOH HOH A . F 4 HOH 64 207 68 HOH HOH A . F 4 HOH 65 208 69 HOH HOH A . F 4 HOH 66 209 70 HOH HOH A . F 4 HOH 67 210 71 HOH HOH A . F 4 HOH 68 211 72 HOH HOH A . F 4 HOH 69 212 73 HOH HOH A . F 4 HOH 70 213 74 HOH HOH A . F 4 HOH 71 214 75 HOH HOH A . F 4 HOH 72 215 76 HOH HOH A . F 4 HOH 73 216 77 HOH HOH A . F 4 HOH 74 217 78 HOH HOH A . F 4 HOH 75 218 79 HOH HOH A . F 4 HOH 76 219 80 HOH HOH A . F 4 HOH 77 220 81 HOH HOH A . F 4 HOH 78 221 82 HOH HOH A . F 4 HOH 79 222 83 HOH HOH A . F 4 HOH 80 223 84 HOH HOH A . F 4 HOH 81 224 85 HOH HOH A . F 4 HOH 82 225 86 HOH HOH A . F 4 HOH 83 226 87 HOH HOH A . F 4 HOH 84 227 88 HOH HOH A . F 4 HOH 85 228 89 HOH HOH A . F 4 HOH 86 229 90 HOH HOH A . F 4 HOH 87 230 91 HOH HOH A . F 4 HOH 88 231 92 HOH HOH A . F 4 HOH 89 232 93 HOH HOH A . F 4 HOH 90 233 94 HOH HOH A . F 4 HOH 91 234 95 HOH HOH A . F 4 HOH 92 235 96 HOH HOH A . F 4 HOH 93 236 97 HOH HOH A . F 4 HOH 94 237 98 HOH HOH A . F 4 HOH 95 238 99 HOH HOH A . F 4 HOH 96 239 100 HOH HOH A . F 4 HOH 97 240 101 HOH HOH A . F 4 HOH 98 241 102 HOH HOH A . F 4 HOH 99 242 103 HOH HOH A . F 4 HOH 100 243 104 HOH HOH A . F 4 HOH 101 244 105 HOH HOH A . F 4 HOH 102 245 106 HOH HOH A . F 4 HOH 103 246 107 HOH HOH A . F 4 HOH 104 247 108 HOH HOH A . F 4 HOH 105 248 109 HOH HOH A . F 4 HOH 106 249 110 HOH HOH A . F 4 HOH 107 250 111 HOH HOH A . F 4 HOH 108 251 112 HOH HOH A . F 4 HOH 109 252 113 HOH HOH A . F 4 HOH 110 253 114 HOH HOH A . F 4 HOH 111 254 115 HOH HOH A . F 4 HOH 112 255 116 HOH HOH A . F 4 HOH 113 256 117 HOH HOH A . F 4 HOH 114 257 118 HOH HOH A . F 4 HOH 115 258 119 HOH HOH A . F 4 HOH 116 259 120 HOH HOH A . F 4 HOH 117 260 121 HOH HOH A . F 4 HOH 118 261 122 HOH HOH A . F 4 HOH 119 262 123 HOH HOH A . F 4 HOH 120 263 124 HOH HOH A . F 4 HOH 121 264 125 HOH HOH A . F 4 HOH 122 265 126 HOH HOH A . F 4 HOH 123 266 127 HOH HOH A . F 4 HOH 124 267 128 HOH HOH A . F 4 HOH 125 268 129 HOH HOH A . F 4 HOH 126 269 130 HOH HOH A . F 4 HOH 127 270 131 HOH HOH A . F 4 HOH 128 271 132 HOH HOH A . F 4 HOH 129 272 133 HOH HOH A . F 4 HOH 130 273 134 HOH HOH A . F 4 HOH 131 274 135 HOH HOH A . F 4 HOH 132 275 136 HOH HOH A . F 4 HOH 133 276 137 HOH HOH A . F 4 HOH 134 277 138 HOH HOH A . F 4 HOH 135 278 139 HOH HOH A . F 4 HOH 136 279 140 HOH HOH A . F 4 HOH 137 280 141 HOH HOH A . F 4 HOH 138 281 142 HOH HOH A . F 4 HOH 139 282 143 HOH HOH A . F 4 HOH 140 283 144 HOH HOH A . F 4 HOH 141 284 145 HOH HOH A . F 4 HOH 142 285 146 HOH HOH A . F 4 HOH 143 286 147 HOH HOH A . F 4 HOH 144 287 148 HOH HOH A . F 4 HOH 145 288 149 HOH HOH A . F 4 HOH 146 289 150 HOH HOH A . F 4 HOH 147 290 151 HOH HOH A . F 4 HOH 148 291 152 HOH HOH A . F 4 HOH 149 292 153 HOH HOH A . F 4 HOH 150 293 154 HOH HOH A . F 4 HOH 151 294 155 HOH HOH A . F 4 HOH 152 295 156 HOH HOH A . F 4 HOH 153 296 157 HOH HOH A . F 4 HOH 154 297 158 HOH HOH A . F 4 HOH 155 298 159 HOH HOH A . F 4 HOH 156 299 160 HOH HOH A . F 4 HOH 157 300 161 HOH HOH A . F 4 HOH 158 301 162 HOH HOH A . F 4 HOH 159 302 163 HOH HOH A . F 4 HOH 160 303 164 HOH HOH A . F 4 HOH 161 304 165 HOH HOH A . F 4 HOH 162 305 166 HOH HOH A . F 4 HOH 163 306 167 HOH HOH A . F 4 HOH 164 307 168 HOH HOH A . F 4 HOH 165 308 169 HOH HOH A . F 4 HOH 166 309 170 HOH HOH A . F 4 HOH 167 310 171 HOH HOH A . F 4 HOH 168 311 172 HOH HOH A . F 4 HOH 169 312 173 HOH HOH A . F 4 HOH 170 313 174 HOH HOH A . F 4 HOH 171 314 175 HOH HOH A . F 4 HOH 172 315 176 HOH HOH A . F 4 HOH 173 316 177 HOH HOH A . F 4 HOH 174 317 178 HOH HOH A . F 4 HOH 175 318 179 HOH HOH A . F 4 HOH 176 319 180 HOH HOH A . F 4 HOH 177 320 181 HOH HOH A . F 4 HOH 178 321 182 HOH HOH A . F 4 HOH 179 322 183 HOH HOH A . F 4 HOH 180 323 184 HOH HOH A . F 4 HOH 181 324 185 HOH HOH A . F 4 HOH 182 325 186 HOH HOH A . F 4 HOH 183 326 187 HOH HOH A . F 4 HOH 184 327 188 HOH HOH A . F 4 HOH 185 328 189 HOH HOH A . F 4 HOH 186 329 190 HOH HOH A . F 4 HOH 187 330 191 HOH HOH A . F 4 HOH 188 331 192 HOH HOH A . F 4 HOH 189 332 193 HOH HOH A . F 4 HOH 190 333 194 HOH HOH A . F 4 HOH 191 334 195 HOH HOH A . F 4 HOH 192 335 196 HOH HOH A . F 4 HOH 193 336 197 HOH HOH A . F 4 HOH 194 337 198 HOH HOH A . F 4 HOH 195 338 199 HOH HOH A . F 4 HOH 196 339 200 HOH HOH A . F 4 HOH 197 340 201 HOH HOH A . F 4 HOH 198 341 202 HOH HOH A . F 4 HOH 199 342 203 HOH HOH A . F 4 HOH 200 343 204 HOH HOH A . F 4 HOH 201 344 205 HOH HOH A . F 4 HOH 202 345 206 HOH HOH A . F 4 HOH 203 346 207 HOH HOH A . F 4 HOH 204 347 208 HOH HOH A . F 4 HOH 205 348 209 HOH HOH A . F 4 HOH 206 349 210 HOH HOH A . F 4 HOH 207 350 211 HOH HOH A . F 4 HOH 208 351 212 HOH HOH A . F 4 HOH 209 352 213 HOH HOH A . F 4 HOH 210 353 214 HOH HOH A . F 4 HOH 211 354 215 HOH HOH A . F 4 HOH 212 355 216 HOH HOH A . F 4 HOH 213 356 217 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA,PQS trimeric 3 2 software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,3 A,B,C,D,E,F 2 1,2,3,4,5,6 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8770 ? 1 MORE -179 ? 1 'SSA (A^2)' 15720 ? 2 'ABSA (A^2)' 18420 ? 2 MORE -395 ? 2 'SSA (A^2)' 30550 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 4 'crystal symmetry operation' 14_666 -y+5/4,-x+5/4,-z+5/4 0.0000000000 -1.0000000000 0.0000000000 137.7425000000 -1.0000000000 0.0000000000 0.0000000000 137.7425000000 0.0000000000 0.0000000000 -1.0000000000 137.7425000000 5 'crystal symmetry operation' 19_666 -x+5/4,-z+5/4,-y+5/4 -1.0000000000 0.0000000000 0.0000000000 137.7425000000 0.0000000000 0.0000000000 -1.0000000000 137.7425000000 0.0000000000 -1.0000000000 0.0000000000 137.7425000000 6 'crystal symmetry operation' 24_666 -z+5/4,-y+5/4,-x+5/4 0.0000000000 0.0000000000 -1.0000000000 137.7425000000 0.0000000000 -1.0000000000 0.0000000000 137.7425000000 -1.0000000000 0.0000000000 0.0000000000 137.7425000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 143 ? E SO4 . 2 1 A HOH 150 ? F HOH . 3 1 A HOH 207 ? F HOH . 4 1 A HOH 233 ? F HOH . 5 1 A HOH 300 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 93 ? A HIS 81 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 OD1 ? A ASN 100 ? A ASN 88 ? 1_555 88.2 ? 2 NE2 ? A HIS 93 ? A HIS 81 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 NE2 ? A HIS 104 ? A HIS 92 ? 1_555 99.1 ? 3 OD1 ? A ASN 100 ? A ASN 88 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 NE2 ? A HIS 104 ? A HIS 92 ? 1_555 91.8 ? 4 NE2 ? A HIS 93 ? A HIS 81 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 199 ? 1_555 84.9 ? 5 OD1 ? A ASN 100 ? A ASN 88 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 199 ? 1_555 81.1 ? 6 NE2 ? A HIS 104 ? A HIS 92 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 199 ? 1_555 171.7 ? 7 NE2 ? A HIS 93 ? A HIS 81 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 208 ? 1_555 93.0 ? 8 OD1 ? A ASN 100 ? A ASN 88 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 208 ? 1_555 169.5 ? 9 NE2 ? A HIS 104 ? A HIS 92 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 208 ? 1_555 98.3 ? 10 O ? F HOH . ? A HOH 199 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 208 ? 1_555 88.6 ? 11 NE2 ? A HIS 93 ? A HIS 81 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 256 ? 1_555 162.9 ? 12 OD1 ? A ASN 100 ? A ASN 88 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 256 ? 1_555 101.0 ? 13 NE2 ? A HIS 104 ? A HIS 92 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 256 ? 1_555 95.0 ? 14 O ? F HOH . ? A HOH 199 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 256 ? 1_555 82.3 ? 15 O ? F HOH . ? A HOH 208 ? 1_555 NA ? B NA . ? A NA 140 ? 1_555 O ? F HOH . ? A HOH 256 ? 1_555 75.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-10-12 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-01-25 5 'Structure model' 1 4 2023-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Source and taxonomy' 5 3 'Structure model' 'Version format compliance' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' pdbx_struct_special_symmetry 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details . _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 48.9810 _pdbx_refine_tls.origin_y 64.1420 _pdbx_refine_tls.origin_z 50.4980 _pdbx_refine_tls.T[1][1] -0.0032 _pdbx_refine_tls.T[2][2] -0.0335 _pdbx_refine_tls.T[3][3] -0.0182 _pdbx_refine_tls.T[1][2] 0.0021 _pdbx_refine_tls.T[1][3] -0.0180 _pdbx_refine_tls.T[2][3] -0.0058 _pdbx_refine_tls.L[1][1] 0.5901 _pdbx_refine_tls.L[2][2] 0.3079 _pdbx_refine_tls.L[3][3] 0.5262 _pdbx_refine_tls.L[1][2] 0.1699 _pdbx_refine_tls.L[1][3] 0.2322 _pdbx_refine_tls.L[2][3] 0.1462 _pdbx_refine_tls.S[1][1] -0.0439 _pdbx_refine_tls.S[2][2] 0.0071 _pdbx_refine_tls.S[3][3] 0.0368 _pdbx_refine_tls.S[1][2] -0.0317 _pdbx_refine_tls.S[1][3] 0.0728 _pdbx_refine_tls.S[2][3] 0.0529 _pdbx_refine_tls.S[2][1] -0.0709 _pdbx_refine_tls.S[3][1] -0.0954 _pdbx_refine_tls.S[3][2] -0.0463 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 13 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 151 _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 139 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data scaling' . ? 1 SCALA 'data scaling' '5.0)' ? 2 MOLREP phasing . ? 3 REFMAC refinement 5.2.0005 ? 4 XDS 'data reduction' . ? 5 CCP4 'data scaling' '(SCALA)' ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 53 ? ? -164.94 -158.61 2 1 ASP A 125 ? ? -151.02 69.20 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 2 ? NZ ? A LYS 14 NZ 2 1 Y 1 A LYS 69 ? CE ? A LYS 81 CE 3 1 Y 1 A LYS 69 ? NZ ? A LYS 81 NZ 4 1 Y 1 A LYS 74 ? CE ? A LYS 86 CE 5 1 Y 1 A LYS 74 ? NZ ? A LYS 86 NZ 6 1 Y 1 A LYS 80 ? CE ? A LYS 92 CE 7 1 Y 1 A LYS 80 ? NZ ? A LYS 92 NZ 8 1 Y 1 A GLU 139 ? CG ? A GLU 151 CG 9 1 Y 1 A GLU 139 ? CD ? A GLU 151 CD 10 1 Y 1 A GLU 139 ? OE1 ? A GLU 151 OE1 11 1 Y 1 A GLU 139 ? OE2 ? A GLU 151 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -11 ? A MET 1 2 1 Y 1 A GLY -10 ? A GLY 2 3 1 Y 1 A SER -9 ? A SER 3 4 1 Y 1 A ASP -8 ? A ASP 4 5 1 Y 1 A LYS -7 ? A LYS 5 6 1 Y 1 A ILE -6 ? A ILE 6 7 1 Y 1 A HIS -5 ? A HIS 7 8 1 Y 1 A HIS -4 ? A HIS 8 9 1 Y 1 A HIS -3 ? A HIS 9 10 1 Y 1 A HIS -2 ? A HIS 10 11 1 Y 1 A HIS -1 ? A HIS 11 12 1 Y 1 A HIS 0 ? A HIS 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NA NA NA N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1VMF _pdbx_initial_refinement_model.details ? #