data_1VPC # _entry.id 1VPC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VPC pdb_00001vpc 10.2210/pdb1vpc/pdb WWPDB D_1000177085 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VPC _pdbx_database_status.recvd_initial_deposition_date 1998-02-20 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schueler, W.' 1 'De Rocquigny, H.' 2 'Baudat, Y.' 3 'Sire, J.' 4 'Roques, B.P.' 5 # _citation.id primary _citation.title ;NMR structure of the (52-96) C-terminal domain of the HIV-1 regulatory protein Vpr: molecular insights into its biological functions. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 285 _citation.page_first 2105 _citation.page_last 2117 _citation.year 1999 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9925788 _citation.pdbx_database_id_DOI 10.1006/jmbi.1998.2381 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schuler, W.' 1 ? primary 'Wecker, K.' 2 ? primary 'de Rocquigny, H.' 3 ? primary 'Baudat, Y.' 4 ? primary 'Sire, J.' 5 ? primary 'Roques, B.P.' 6 ? # _cell.entry_id 1VPC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VPC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'VPR PROTEIN' _entity.formula_weight 5257.138 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL DOMAIN, RESIDUES 52-96' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VPR HIV-1 (LAI)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DTWTGVEALIRILQQLLFIHFRIGCRHSRIGIIQQRRTRNGASKS _entity_poly.pdbx_seq_one_letter_code_can DTWTGVEALIRILQQLLFIHFRIGCRHSRIGIIQQRRTRNGASKS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 THR n 1 3 TRP n 1 4 THR n 1 5 GLY n 1 6 VAL n 1 7 GLU n 1 8 ALA n 1 9 LEU n 1 10 ILE n 1 11 ARG n 1 12 ILE n 1 13 LEU n 1 14 GLN n 1 15 GLN n 1 16 LEU n 1 17 LEU n 1 18 PHE n 1 19 ILE n 1 20 HIS n 1 21 PHE n 1 22 ARG n 1 23 ILE n 1 24 GLY n 1 25 CYS n 1 26 ARG n 1 27 HIS n 1 28 SER n 1 29 ARG n 1 30 ILE n 1 31 GLY n 1 32 ILE n 1 33 ILE n 1 34 GLN n 1 35 GLN n 1 36 ARG n 1 37 ARG n 1 38 THR n 1 39 ARG n 1 40 ASN n 1 41 GLY n 1 42 ALA n 1 43 SER n 1 44 LYS n 1 45 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q73369_9HIV1 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q73369 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEQAPEDQGPQREPYNDWTLELLEELKNEAVRHFPRIWLHSLGQHIYETYGDTWTGVEALIRILQQLLFIHFRIGCRHSR IGIIQQRRTRNGASKS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VPC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q73369 _struct_ref_seq.db_align_beg 52 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 52 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 E.COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'LOW SALT CONDITIONS' _pdbx_nmr_exptl_sample_conditions.pressure_units ATMOSPHERE _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '70% H2O 30% TFE' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1VPC _pdbx_nmr_refine.method 'DYNAMICAL SIMULATED ANNEALING, MOLECULAR DYNAMICS, ENERGY MINIMIZATION' _pdbx_nmr_refine.details ;SEVENTY STRUCTURES WERE GENERATED BY SIMULATED ANNEALING AND FIFTEEN SELECTED STRUCTURES FURTHER REFINED BY RESTRAINED MOLECULAR DYNAMICS (5PS 1000K, 10PS 600K, 55PS 300K) FOLLOWED BY ENERGY MINIMIZATION. THE BEST STRUCTURE SELECTED WITH RESPECT TO RESTRAINT VIOLATIONS AND TOTAL ENERGY IS PRESENTED IN THIS ENTRY. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1VPC _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING 1H-NMR SPECTROSCOPY ON THE C-TERMINAL DOMAIN (52-96)VPR.' # _pdbx_nmr_ensemble.entry_id 1VPC _pdbx_nmr_ensemble.conformers_calculated_total_number 15 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATIONS, LOWEST TOTAL ENERGY' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Discover ? BIOSYM 1 'structure solution' 'BRUKER UXNMR' UXNMR ? 2 'structure solution' 'BIOSYM/MSI FELIX' FELIX ? 3 # _exptl.entry_id 1VPC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1VPC _struct.title 'C-TERMINAL DOMAIN (52-96) OF THE HIV-1 REGULATORY PROTEIN VPR, NMR, 1 STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VPC _struct_keywords.pdbx_keywords 'REGULATORY PROTEIN' _struct_keywords.text 'REGULATORY PROTEIN, HELICAL DOMAIN, LEUCINE-ZIPPER' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id TRP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 3 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TRP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 54 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 76 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1VPC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1VPC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 52 52 ASP ASP A . n A 1 2 THR 2 53 53 THR THR A . n A 1 3 TRP 3 54 54 TRP TRP A . n A 1 4 THR 4 55 55 THR THR A . n A 1 5 GLY 5 56 56 GLY GLY A . n A 1 6 VAL 6 57 57 VAL VAL A . n A 1 7 GLU 7 58 58 GLU GLU A . n A 1 8 ALA 8 59 59 ALA ALA A . n A 1 9 LEU 9 60 60 LEU LEU A . n A 1 10 ILE 10 61 61 ILE ILE A . n A 1 11 ARG 11 62 62 ARG ARG A . n A 1 12 ILE 12 63 63 ILE ILE A . n A 1 13 LEU 13 64 64 LEU LEU A . n A 1 14 GLN 14 65 65 GLN GLN A . n A 1 15 GLN 15 66 66 GLN GLN A . n A 1 16 LEU 16 67 67 LEU LEU A . n A 1 17 LEU 17 68 68 LEU LEU A . n A 1 18 PHE 18 69 69 PHE PHE A . n A 1 19 ILE 19 70 70 ILE ILE A . n A 1 20 HIS 20 71 71 HIS HIS A . n A 1 21 PHE 21 72 72 PHE PHE A . n A 1 22 ARG 22 73 73 ARG ARG A . n A 1 23 ILE 23 74 74 ILE ILE A . n A 1 24 GLY 24 75 75 GLY GLY A . n A 1 25 CYS 25 76 76 CYS CYS A . n A 1 26 ARG 26 77 77 ARG ARG A . n A 1 27 HIS 27 78 78 HIS HIS A . n A 1 28 SER 28 79 79 SER SER A . n A 1 29 ARG 29 80 80 ARG ARG A . n A 1 30 ILE 30 81 81 ILE ILE A . n A 1 31 GLY 31 82 82 GLY GLY A . n A 1 32 ILE 32 83 83 ILE ILE A . n A 1 33 ILE 33 84 84 ILE ILE A . n A 1 34 GLN 34 85 85 GLN GLN A . n A 1 35 GLN 35 86 86 GLN GLN A . n A 1 36 ARG 36 87 87 ARG ARG A . n A 1 37 ARG 37 88 88 ARG ARG A . n A 1 38 THR 38 89 89 THR THR A . n A 1 39 ARG 39 90 90 ARG ARG A . n A 1 40 ASN 40 91 91 ASN ASN A . n A 1 41 GLY 41 92 92 GLY GLY A . n A 1 42 ALA 42 93 93 ALA ALA A . n A 1 43 SER 43 94 94 SER SER A . n A 1 44 LYS 44 95 95 LYS LYS A . n A 1 45 SER 45 96 96 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-03-23 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 78 ? ? CD2 A HIS 78 ? ? 1.415 1.354 0.061 0.009 N 2 1 C A SER 96 ? ? OXT A SER 96 ? ? 1.380 1.229 0.151 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH1 A ARG 62 ? ? 124.13 120.30 3.83 0.50 N 2 1 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.06 120.30 3.76 0.50 N 3 1 NE A ARG 77 ? ? CZ A ARG 77 ? ? NH1 A ARG 77 ? ? 124.07 120.30 3.77 0.50 N 4 1 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.05 120.30 3.75 0.50 N 5 1 NE A ARG 87 ? ? CZ A ARG 87 ? ? NH1 A ARG 87 ? ? 123.98 120.30 3.68 0.50 N 6 1 NE A ARG 88 ? ? CZ A ARG 88 ? ? NH1 A ARG 88 ? ? 124.00 120.30 3.70 0.50 N 7 1 NE A ARG 90 ? ? CZ A ARG 90 ? ? NH1 A ARG 90 ? ? 124.20 120.30 3.90 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 78 ? ? -110.49 -72.40 2 1 ARG A 80 ? ? 76.62 64.49 3 1 ILE A 81 ? ? -95.69 -74.04 4 1 ILE A 83 ? ? 63.36 71.87 5 1 GLN A 85 ? ? -155.53 -59.24 6 1 ARG A 88 ? ? -102.53 -72.82 #