data_1VRF # _entry.id 1VRF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.318 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1VRF RCSB RCSB000720 WWPDB D_1000000720 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VRF _pdbx_database_status.recvd_initial_deposition_date 1999-03-25 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Volkman, B.F.' 1 'Alam, S.L.' 2 'Satterlee, J.D.' 3 'Markley, J.L.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure and backbone dynamics of component IV Glycera dibranchiata monomeric hemoglobin-CO.' Biochemistry 37 10906 10919 1998 BICHAW US 0006-2960 0033 ? 9692983 10.1021/bi980810b 1 'Detailed NMR analysis of the heme-protein interactions in component IV Glycera dibranchiata monomeric hemoglobin-CO.' J.Biomol.Nmr 11 119 133 1998 JBNME9 NE 0925-2738 0800 ? 9679291 10.1023/a:1008202621725 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Volkman, B.F.' 1 ? primary 'Alam, S.L.' 2 ? primary 'Satterlee, J.D.' 3 ? primary 'Markley, J.L.' 4 ? 1 'Alam, S.L.' 5 ? 1 'Volkman, B.F.' 6 ? 1 'Markley, J.L.' 7 ? 1 'Satterlee, J.D.' 8 ? # _cell.entry_id 1VRF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VRF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (GLOBIN, MONOMERIC COMPONENT M-IV)' 15049.072 1 ? ? ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 'CARBON MONOXIDE' 28.010 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GHM4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GLSAAQRQVVASTWKDIAGSDNGAGVGKECFTKFLSAHHDMAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGKMV AEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGLQS ; _entity_poly.pdbx_seq_one_letter_code_can ;GLSAAQRQVVASTWKDIAGSDNGAGVGKECFTKFLSAHHDMAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGKMV AEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGLQS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 SER n 1 4 ALA n 1 5 ALA n 1 6 GLN n 1 7 ARG n 1 8 GLN n 1 9 VAL n 1 10 VAL n 1 11 ALA n 1 12 SER n 1 13 THR n 1 14 TRP n 1 15 LYS n 1 16 ASP n 1 17 ILE n 1 18 ALA n 1 19 GLY n 1 20 SER n 1 21 ASP n 1 22 ASN n 1 23 GLY n 1 24 ALA n 1 25 GLY n 1 26 VAL n 1 27 GLY n 1 28 LYS n 1 29 GLU n 1 30 CYS n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PHE n 1 35 LEU n 1 36 SER n 1 37 ALA n 1 38 HIS n 1 39 HIS n 1 40 ASP n 1 41 MET n 1 42 ALA n 1 43 ALA n 1 44 VAL n 1 45 PHE n 1 46 GLY n 1 47 PHE n 1 48 SER n 1 49 GLY n 1 50 ALA n 1 51 SER n 1 52 ASP n 1 53 PRO n 1 54 GLY n 1 55 VAL n 1 56 ALA n 1 57 ASP n 1 58 LEU n 1 59 GLY n 1 60 ALA n 1 61 LYS n 1 62 VAL n 1 63 LEU n 1 64 ALA n 1 65 GLN n 1 66 ILE n 1 67 GLY n 1 68 VAL n 1 69 ALA n 1 70 VAL n 1 71 SER n 1 72 HIS n 1 73 LEU n 1 74 GLY n 1 75 ASP n 1 76 GLU n 1 77 GLY n 1 78 LYS n 1 79 MET n 1 80 VAL n 1 81 ALA n 1 82 GLU n 1 83 MET n 1 84 LYS n 1 85 ALA n 1 86 VAL n 1 87 GLY n 1 88 VAL n 1 89 ARG n 1 90 HIS n 1 91 LYS n 1 92 GLY n 1 93 TYR n 1 94 GLY n 1 95 ASN n 1 96 LYS n 1 97 HIS n 1 98 ILE n 1 99 LYS n 1 100 ALA n 1 101 GLU n 1 102 TYR n 1 103 PHE n 1 104 GLU n 1 105 PRO n 1 106 LEU n 1 107 GLY n 1 108 ALA n 1 109 SER n 1 110 LEU n 1 111 LEU n 1 112 SER n 1 113 ALA n 1 114 MET n 1 115 GLU n 1 116 HIS n 1 117 ARG n 1 118 ILE n 1 119 GLY n 1 120 GLY n 1 121 LYS n 1 122 MET n 1 123 ASN n 1 124 ALA n 1 125 ALA n 1 126 ALA n 1 127 LYS n 1 128 ASP n 1 129 ALA n 1 130 TRP n 1 131 ALA n 1 132 ALA n 1 133 ALA n 1 134 TYR n 1 135 ALA n 1 136 ASP n 1 137 ILE n 1 138 SER n 1 139 GLY n 1 140 ALA n 1 141 LEU n 1 142 ILE n 1 143 SER n 1 144 GLY n 1 145 LEU n 1 146 GLN n 1 147 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Glycera _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue BLOOD _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Glycera dibranchiata' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6350 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ERYTHROCYTE _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET9D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'RECOMBINANT PROTEIN WAS PRODUCED IN E. COLI' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLB4_GLYDI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P15447 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VRF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15447 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CMO non-polymer . 'CARBON MONOXIDE' ? 'C O' 28.010 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'NOEY & QUANTITATIVE J-CORRELATION' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM KCL' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 499.84 ? 2 DMX Bruker 500.13 ? 3 DMX Bruker 600.13 ? 4 DMX Bruker 750.13 ? # _pdbx_nmr_refine.entry_id 1VRF _pdbx_nmr_refine.method 'HYBRID DISTANCE GEOMETRY/ SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINED ITERATIVELY WITH X-PLOR AND PERL SCRIPTS WRITTEN IN-HOUSE AS DESCRIBED IN JRNL CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1VRF _pdbx_nmr_details.text '3D 15N NOESY-HSQC; 3D 13C NOESY-HSQC; 4D 13C/15N NOESY-HSQC; 3D HNHB; 3D HNCOHB; 2D JCC; 2D JNC; 3D HNHA; 2D LRCC' # _pdbx_nmr_ensemble.entry_id 1VRF _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.843 BRUNGER 1 'structure solution' X-PLOR 3.843 ? 2 # _exptl.entry_id 1VRF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1VRF _struct.title 'SOLUTION STRUCTURE OF COMPONENT IV GLYCERA DIBRANCHIATA MONOMERIC HEMOGLOBIN-CO' _struct.pdbx_descriptor 'GLOBIN, MONOMERIC COMPONENT M-IV' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VRF _struct_keywords.pdbx_keywords 'HEME PROTEIN' _struct_keywords.text 'HEME PROTEIN, GLOBIN, OXYGEN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 4 ? ILE A 17 ? ALA A 4 ILE A 17 1 ? 14 HELX_P HELX_P2 2 ALA A 24 ? GLY A 27 ? ALA A 24 GLY A 27 1 ? 4 HELX_P HELX_P3 3 CYS A 30 ? ALA A 37 ? CYS A 30 ALA A 37 1 ? 8 HELX_P HELX_P4 4 HIS A 39 ? PHE A 45 ? HIS A 39 PHE A 45 1 ? 7 HELX_P HELX_P5 5 GLY A 54 ? VAL A 70 ? GLY A 54 VAL A 70 1 ? 17 HELX_P HELX_P6 6 MET A 79 ? GLY A 92 ? MET A 79 GLY A 92 1 ? 14 HELX_P HELX_P7 7 ALA A 100 ? ARG A 117 ? ALA A 100 ARG A 117 1 ? 18 HELX_P HELX_P8 8 ALA A 124 ? ILE A 142 ? ALA A 124 ILE A 142 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 90 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 90 A HEM 148 1_555 ? ? ? ? ? ? ? 2.202 ? metalc2 metalc ? ? B HEM . FE ? ? ? 1_555 C CMO . C ? ? A HEM 148 A CMO 149 1_555 ? ? ? ? ? ? ? 1.901 ? metalc3 metalc ? ? B HEM . FE ? ? ? 1_555 C CMO . O ? ? A HEM 148 A CMO 149 1_555 ? ? ? ? ? ? ? 3.029 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details LIG Author ? ? ? ? 1 'HIS A 90 NE2-HEME FE COORDINATE-COVALENT BOND' AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HEM A 148' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CMO A 149' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 LIG 1 HIS A 90 ? HIS A 90 . ? 1_555 ? 2 AC1 12 PHE A 34 ? PHE A 34 . ? 1_555 ? 3 AC1 12 MET A 41 ? MET A 41 . ? 1_555 ? 4 AC1 12 VAL A 44 ? VAL A 44 . ? 1_555 ? 5 AC1 12 PHE A 45 ? PHE A 45 . ? 1_555 ? 6 AC1 12 LEU A 58 ? LEU A 58 . ? 1_555 ? 7 AC1 12 VAL A 62 ? VAL A 62 . ? 1_555 ? 8 AC1 12 HIS A 90 ? HIS A 90 . ? 1_555 ? 9 AC1 12 TYR A 93 ? TYR A 93 . ? 1_555 ? 10 AC1 12 TYR A 102 ? TYR A 102 . ? 1_555 ? 11 AC1 12 PHE A 103 ? PHE A 103 . ? 1_555 ? 12 AC1 12 LEU A 141 ? LEU A 141 . ? 1_555 ? 13 AC1 12 CMO C . ? CMO A 149 . ? 1_555 ? 14 AC2 4 PHE A 31 ? PHE A 31 . ? 1_555 ? 15 AC2 4 PHE A 45 ? PHE A 45 . ? 1_555 ? 16 AC2 4 VAL A 62 ? VAL A 62 . ? 1_555 ? 17 AC2 4 HEM B . ? HEM A 148 . ? 1_555 ? # _database_PDB_matrix.entry_id 1VRF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1VRF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 SER 147 147 147 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 148 148 HEM HEM A . C 3 CMO 1 149 148 CMO CO A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1250 ? 1 MORE -19 ? 1 'SSA (A^2)' 6910 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 NA ? B HEM . ? A HEM 148 ? 1_555 90.0 ? 2 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 NB ? B HEM . ? A HEM 148 ? 1_555 90.3 ? 3 NA ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 NB ? B HEM . ? A HEM 148 ? 1_555 90.0 ? 4 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 NC ? B HEM . ? A HEM 148 ? 1_555 90.3 ? 5 NA ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 NC ? B HEM . ? A HEM 148 ? 1_555 179.7 ? 6 NB ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 NC ? B HEM . ? A HEM 148 ? 1_555 90.0 ? 7 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 ND ? B HEM . ? A HEM 148 ? 1_555 90.0 ? 8 NA ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 ND ? B HEM . ? A HEM 148 ? 1_555 90.0 ? 9 NB ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 ND ? B HEM . ? A HEM 148 ? 1_555 179.8 ? 10 NC ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 ND ? B HEM . ? A HEM 148 ? 1_555 90.0 ? 11 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 C ? C CMO . ? A CMO 149 ? 1_555 179.9 ? 12 NA ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 C ? C CMO . ? A CMO 149 ? 1_555 89.9 ? 13 NB ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 C ? C CMO . ? A CMO 149 ? 1_555 89.9 ? 14 NC ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 C ? C CMO . ? A CMO 149 ? 1_555 89.8 ? 15 ND ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 C ? C CMO . ? A CMO 149 ? 1_555 89.9 ? 16 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 O ? C CMO . ? A CMO 149 ? 1_555 179.9 ? 17 NA ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 O ? C CMO . ? A CMO 149 ? 1_555 89.9 ? 18 NB ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 O ? C CMO . ? A CMO 149 ? 1_555 89.8 ? 19 NC ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 O ? C CMO . ? A CMO 149 ? 1_555 89.8 ? 20 ND ? B HEM . ? A HEM 148 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 O ? C CMO . ? A CMO 149 ? 1_555 89.9 ? 21 C ? C CMO . ? A CMO 149 ? 1_555 FE ? B HEM . ? A HEM 148 ? 1_555 O ? C CMO . ? A CMO 149 ? 1_555 0.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-04-01 2 'Structure model' 1 1 2007-10-16 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' citation 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_assembly_prop 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_atom_id' 6 4 'Structure model' '_atom_site.label_atom_id' 7 4 'Structure model' '_citation.journal_abbrev' 8 4 'Structure model' '_citation.page_first' 9 4 'Structure model' '_citation.pdbx_database_id_DOI' 10 4 'Structure model' '_citation.pdbx_database_id_PubMed' 11 4 'Structure model' '_citation.title' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 72 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 75 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 16 ? ? -120.67 -50.29 2 1 SER A 36 ? ? -64.07 -70.97 3 1 SER A 71 ? ? -89.91 31.04 4 1 HIS A 72 ? ? -159.53 -43.27 5 1 LEU A 73 ? ? 42.87 -88.76 6 1 ASP A 75 ? ? -64.67 89.82 7 1 HIS A 97 ? ? -128.39 -93.89 8 1 ILE A 98 ? ? 61.48 134.20 9 1 ILE A 118 ? ? -91.97 53.38 10 1 MET A 122 ? ? -64.09 94.09 11 1 GLN A 146 ? ? 57.14 81.33 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 7 ? ? 0.192 'SIDE CHAIN' 2 1 ARG A 89 ? ? 0.223 'SIDE CHAIN' 3 1 ARG A 117 ? ? 0.315 'SIDE CHAIN' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 'CARBON MONOXIDE' CMO #