data_1W2R # _entry.id 1W2R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1W2R PDBE EBI-20083 WWPDB D_1290020083 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1GHQ unspecified 'CR2-C3D COMPLEX STRUCTURE' PDB 1LY2 unspecified 'CRYSTAL STRUCTURE OF UNLIGANDED HUMAN CD21 SCR1-SCR2(COMPLEMENT RECEPTOR TYPE 2)' PDB 1W2S unspecified 'SOLUTION STRUCTURE OF CR2 SCR 1-2 IN ITS COMPLEX WITH C3D BY X-RAY SCATTERING' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1W2R _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-07-08 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gilbert, H.E.' 1 'Hannan, J.P.' 2 'Holers, V.M.' 3 'Perkins, S.J.' 4 # _citation.id primary _citation.title ;Solution Structure of the Complex between Cr2 Scr 1-2 and C3D of Human Complement: An X-Ray Scattering and Sedimentation Modelling Study. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 346 _citation.page_first 859 _citation.page_last ? _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15713468 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2004.12.006 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gilbert, H.E.' 1 primary 'Eaton, J.T.' 2 primary 'Hannan, J.P.' 3 primary 'Holers, V.M.' 4 primary 'Perkins, S.J.' 5 # _cell.entry_id 1W2R _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1W2R _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'COMPLEMENT RECEPTOR TYPE 2 PRECURSOR,' _entity.formula_weight 15611.923 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CR2 SCR 1-2, COMPLEMENT C3D RECEPTOR, EPSTEIN-BARR VIRUS RECEPTOR, EBV RECEPTOR, CD21 ANTIGEN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EAEAISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCQYFNKYSSCPEPIV PGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLEQKLIS ; _entity_poly.pdbx_seq_one_letter_code_can ;EAEAISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCQYFNKYSSCPEPIV PGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLEQKLIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ALA n 1 3 GLU n 1 4 ALA n 1 5 ILE n 1 6 SER n 1 7 CYS n 1 8 GLY n 1 9 SER n 1 10 PRO n 1 11 PRO n 1 12 PRO n 1 13 ILE n 1 14 LEU n 1 15 ASN n 1 16 GLY n 1 17 ARG n 1 18 ILE n 1 19 SER n 1 20 TYR n 1 21 TYR n 1 22 SER n 1 23 THR n 1 24 PRO n 1 25 ILE n 1 26 ALA n 1 27 VAL n 1 28 GLY n 1 29 THR n 1 30 VAL n 1 31 ILE n 1 32 ARG n 1 33 TYR n 1 34 SER n 1 35 CYS n 1 36 SER n 1 37 GLY n 1 38 THR n 1 39 PHE n 1 40 ARG n 1 41 LEU n 1 42 ILE n 1 43 GLY n 1 44 GLU n 1 45 LYS n 1 46 SER n 1 47 LEU n 1 48 LEU n 1 49 CYS n 1 50 ILE n 1 51 THR n 1 52 LYS n 1 53 ASP n 1 54 LYS n 1 55 VAL n 1 56 ASP n 1 57 GLY n 1 58 THR n 1 59 TRP n 1 60 ASP n 1 61 LYS n 1 62 PRO n 1 63 ALA n 1 64 PRO n 1 65 LYS n 1 66 CYS n 1 67 GLN n 1 68 TYR n 1 69 PHE n 1 70 ASN n 1 71 LYS n 1 72 TYR n 1 73 SER n 1 74 SER n 1 75 CYS n 1 76 PRO n 1 77 GLU n 1 78 PRO n 1 79 ILE n 1 80 VAL n 1 81 PRO n 1 82 GLY n 1 83 GLY n 1 84 TYR n 1 85 LYS n 1 86 ILE n 1 87 ARG n 1 88 GLY n 1 89 SER n 1 90 THR n 1 91 PRO n 1 92 TYR n 1 93 ARG n 1 94 HIS n 1 95 GLY n 1 96 ASP n 1 97 SER n 1 98 VAL n 1 99 THR n 1 100 PHE n 1 101 ALA n 1 102 CYS n 1 103 LYS n 1 104 THR n 1 105 ASN n 1 106 PHE n 1 107 SER n 1 108 MET n 1 109 ASN n 1 110 GLY n 1 111 ASN n 1 112 LYS n 1 113 SER n 1 114 VAL n 1 115 TRP n 1 116 CYS n 1 117 GLN n 1 118 ALA n 1 119 ASN n 1 120 ASN n 1 121 MET n 1 122 TRP n 1 123 GLY n 1 124 PRO n 1 125 THR n 1 126 ARG n 1 127 LEU n 1 128 PRO n 1 129 THR n 1 130 CYS n 1 131 VAL n 1 132 SER n 1 133 VAL n 1 134 PHE n 1 135 PRO n 1 136 LEU n 1 137 GLU n 1 138 GLN n 1 139 LYS n 1 140 LEU n 1 141 ILE n 1 142 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'PICHIA PASTORIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1W2R 1 ? ? 1W2R ? 2 UNP CR2_HUMAN 1 ? ? P20023 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1W2R A 1 ? 4 ? 1W2R 1 ? 4 ? 1 4 2 2 1W2R A 5 ? 137 ? P20023 21 ? 153 ? 5 137 3 1 1W2R A 138 ? 142 ? 1W2R 138 ? 142 ? 138 142 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1W2R _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 67 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P20023 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 83 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 67 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1W2R _exptl.method 'SOLUTION SCATTERING' _exptl.crystals_number ? # _refine_hist.pdbx_refine_id 'SOLUTION SCATTERING' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 142 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 142 _refine_hist.d_res_high . _refine_hist.d_res_low . # _struct.entry_id 1W2R _struct.title 'Solution structure of CR2 SCR 1-2 by X-ray scattering' _struct.pdbx_descriptor 'COMPLEMENT RECEPTOR TYPE 2 PRECURSOR,' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'CA ATOMS ONLY, CHAIN A' # _struct_keywords.entry_id 1W2R _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'IMMUNE SYSTEM, ANALYTICAL ULTRACENTRIFUGATION, THROMBOSPONDIN TYPE I REPEATS, CONSTRAINED MODELLING, GLYCOPROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _database_PDB_matrix.entry_id 1W2R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1W2R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_type.symbol C # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 TRP 122 122 122 TRP TRP A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 SER 142 142 142 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2005-09-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _software.name INSIGHT _software.classification refinement _software.version 'II 98' _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 CA A SER 107 ? ? CA A PRO 135 ? ? 1.98 2 3 CA A SER 73 ? ? CA A ASN 120 ? ? 2.00 3 4 CA A TYR 72 ? ? CA A ASN 119 ? ? 1.89 4 4 CA A SER 107 ? ? CA A PRO 135 ? ? 1.98 5 5 CA A SER 73 ? ? CA A ASN 120 ? ? 2.10 # _pdbx_coordinate_model.asym_id A _pdbx_coordinate_model.type 'CA ATOMS ONLY' # loop_ _pdbx_soln_scatter.id _pdbx_soln_scatter.type _pdbx_soln_scatter.source_type _pdbx_soln_scatter.source_class _pdbx_soln_scatter.source_beamline _pdbx_soln_scatter.source_beamline_instrument _pdbx_soln_scatter.detector_type _pdbx_soln_scatter.detector_specific _pdbx_soln_scatter.temperature _pdbx_soln_scatter.num_time_frames _pdbx_soln_scatter.concentration_range _pdbx_soln_scatter.buffer_name _pdbx_soln_scatter.data_reduction_software_list _pdbx_soln_scatter.data_analysis_software_list _pdbx_soln_scatter.mean_guiner_radius _pdbx_soln_scatter.mean_guiner_radius_esd _pdbx_soln_scatter.min_mean_cross_sectional_radii_gyration _pdbx_soln_scatter.min_mean_cross_sectional_radii_gyration_esd _pdbx_soln_scatter.max_mean_cross_sectional_radii_gyration _pdbx_soln_scatter.max_mean_cross_sectional_radii_gyration_esd _pdbx_soln_scatter.protein_length _pdbx_soln_scatter.entry_id _pdbx_soln_scatter.sample_pH 1 x-ray 'ESRF BEAMLINE ID02' Y ? ? 'FRELON CCD CAMERA' ? 288 1 0.6-10.2 '10 MM HEPES, 50 MM NACL' MULTICCD ? 2.12 0.05 1.00 0.10 ? ? 10 1W2R ? 2 modelling ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1W2R ? # _pdbx_soln_scatter_model.scatter_id 2 _pdbx_soln_scatter_model.id 1 _pdbx_soln_scatter_model.method ? _pdbx_soln_scatter_model.software_list 'INSIGHT II, SCTPL7, GNOM' _pdbx_soln_scatter_model.software_author_list MSI _pdbx_soln_scatter_model.entry_fitting_list ? _pdbx_soln_scatter_model.details ? _pdbx_soln_scatter_model.num_conformers_calculated ? _pdbx_soln_scatter_model.num_conformers_submitted 6 _pdbx_soln_scatter_model.conformer_selection_criteria ? _pdbx_soln_scatter_model.representative_conformer 1 #