data_1W53 # _entry.id 1W53 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1W53 PDBE EBI-20670 WWPDB D_1290020670 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1W53 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-08-05 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Delumeau, O.' 1 'Dutta, S.' 2 'Brigulla, M.' 3 'Kuhnke, G.' 4 'Hardwick, S.W.' 5 'Voelker, U.' 6 'Yudkin, M.D.' 7 'Lewis, R.J.' 8 # _citation.id primary _citation.title 'Functional and Structural Characterization of Rsbu, a Stress Signaling Protein Phosphatase 2C' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 279 _citation.page_first 40927 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15263010 _citation.pdbx_database_id_DOI 10.1074/JBC.M405464200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Delumeau, O.' 1 primary 'Dutta, S.' 2 primary 'Brigulla, M.' 3 primary 'Kuhnke, G.' 4 primary 'Hardwicku, S.W.' 5 primary 'Voelker, U.' 6 primary 'Yudkin, M.D.' 7 primary 'Lewis, R.J.' 8 # _cell.entry_id 1W53 _cell.length_a 42.614 _cell.length_b 45.303 _cell.length_c 77.439 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1W53 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHOSPHOSERINE PHOSPHATASE RSBU' 10086.598 1 ? ? 'N-TERMINAL DOMAIN, RESIDUES 1-84' ? 2 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 3 non-polymer syn XENON 131.293 1 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RSBU, SIGMA FACTOR SIGB REGULATION PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGY GMAY ; _entity_poly.pdbx_seq_one_letter_code_can ;MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGY GMAY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 PHE n 1 4 ARG n 1 5 GLU n 1 6 VAL n 1 7 ILE n 1 8 GLU n 1 9 GLN n 1 10 ARG n 1 11 TYR n 1 12 HIS n 1 13 GLN n 1 14 LEU n 1 15 LEU n 1 16 SER n 1 17 ARG n 1 18 TYR n 1 19 ILE n 1 20 ALA n 1 21 GLU n 1 22 LEU n 1 23 THR n 1 24 GLU n 1 25 THR n 1 26 SER n 1 27 LEU n 1 28 TYR n 1 29 GLN n 1 30 ALA n 1 31 GLN n 1 32 LYS n 1 33 PHE n 1 34 SER n 1 35 ARG n 1 36 LYS n 1 37 THR n 1 38 ILE n 1 39 GLU n 1 40 HIS n 1 41 GLN n 1 42 ILE n 1 43 PRO n 1 44 PRO n 1 45 GLU n 1 46 GLU n 1 47 ILE n 1 48 ILE n 1 49 SER n 1 50 ILE n 1 51 HIS n 1 52 ARG n 1 53 LYS n 1 54 VAL n 1 55 LEU n 1 56 LYS n 1 57 GLU n 1 58 LEU n 1 59 TYR n 1 60 PRO n 1 61 SER n 1 62 LEU n 1 63 PRO n 1 64 GLU n 1 65 ASP n 1 66 VAL n 1 67 PHE n 1 68 HIS n 1 69 SER n 1 70 LEU n 1 71 ASP n 1 72 PHE n 1 73 LEU n 1 74 ILE n 1 75 GLU n 1 76 VAL n 1 77 MET n 1 78 ILE n 1 79 GLY n 1 80 TYR n 1 81 GLY n 1 82 MET n 1 83 ALA n 1 84 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BACILLUS SUBTILIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET22B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RSBU_BACSU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P40399 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1W53 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P40399 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XE non-polymer . XENON ? Xe 131.293 # _exptl.entry_id 1W53 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2 _exptl_crystal.density_percent_sol 38.7 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '12% PEG 6000 100 MM MES.NAOH, PH 6.5' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2002-07-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength 0.933 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1W53 _reflns.observed_criterion_sigma_I 1.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 31.010 _reflns.d_resolution_high 1.600 _reflns.number_obs 9645 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.07000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 4.1400 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.860 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.69 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.16000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.990 _reflns_shell.pdbx_redundancy 4.08 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1W53 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9638 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 28.87 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.199 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.198 _refine.ls_R_factor_R_free 0.227 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.900 _refine.ls_number_reflns_R_free 499 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.B_iso_mean 20.68 _refine.aniso_B[1][1] 1.17000 _refine.aniso_B[2][2] -0.08000 _refine.aniso_B[3][3] -1.08000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.178 _refine.pdbx_overall_ESU_R_Free 0.106 _refine.overall_SU_ML 0.065 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.784 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 710 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 762 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 28.87 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.021 ? 762 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 714 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.604 1.971 ? 1031 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.933 3.000 ? 1670 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 3.876 5.000 ? 89 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.100 0.200 ? 117 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.012 0.020 ? 804 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.015 0.020 ? 153 'X-RAY DIFFRACTION' ? r_nbd_refined 0.220 0.200 ? 174 'X-RAY DIFFRACTION' ? r_nbd_other 0.223 0.200 ? 830 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other 0.089 0.200 ? 430 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.219 0.200 ? 28 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.127 0.200 ? 18 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.252 0.200 ? 84 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.237 0.200 ? 10 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.533 1.500 ? 439 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.254 2.000 ? 728 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.923 3.000 ? 323 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 4.339 4.500 ? 301 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.60 _refine_ls_shell.d_res_low 1.65 _refine_ls_shell.number_reflns_R_work 728 _refine_ls_shell.R_factor_R_work 0.1770 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2510 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1W53 _struct.title 'Kinase recruitment domain of the stress phosphatase RsbU' _struct.pdbx_descriptor 'PHOSPHOSERINE PHOSPHATASE RSBU' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1W53 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'PHOSPHATASE, STRESS, BACILLUS, KINASE, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? LEU A 22 ? MET A 1 LEU A 22 1 ? 22 HELX_P HELX_P2 2 THR A 23 ? HIS A 40 ? THR A 23 HIS A 40 1 ? 18 HELX_P HELX_P3 3 PRO A 43 ? TYR A 59 ? PRO A 43 TYR A 59 1 ? 17 HELX_P HELX_P4 4 PRO A 63 ? TYR A 84 ? PRO A 63 TYR A 84 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 1085' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 1086' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLN A 31 ? GLN A 31 . ? 4_556 ? 2 AC1 6 PRO A 60 ? PRO A 60 . ? 8_456 ? 3 AC1 6 GLU A 75 ? GLU A 75 . ? 1_555 ? 4 AC1 6 ILE A 78 ? ILE A 78 . ? 1_555 ? 5 AC1 6 MET A 82 ? MET A 82 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 2034 . ? 1_555 ? 7 AC2 7 GLU A 45 ? GLU A 45 . ? 8_556 ? 8 AC2 7 GLU A 46 ? GLU A 46 . ? 8_556 ? 9 AC2 7 LYS A 56 ? LYS A 56 . ? 1_555 ? 10 AC2 7 PRO A 60 ? PRO A 60 . ? 1_555 ? 11 AC2 7 SER A 61 ? SER A 61 . ? 1_555 ? 12 AC2 7 GLU A 64 ? GLU A 64 . ? 1_555 ? 13 AC2 7 ILE A 74 ? ILE A 74 . ? 8_556 ? # _database_PDB_matrix.entry_id 1W53 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1W53 _atom_sites.fract_transf_matrix[1][1] 0.023466 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022074 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012913 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S XE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 TYR 84 84 84 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 1085 1085 GOL GOL A . C 2 GOL 1 1086 1086 GOL GOL A . D 3 XE 1 1087 1087 XE XE A . E 4 HOH 1 2001 2001 HOH HOH A . E 4 HOH 2 2002 2002 HOH HOH A . E 4 HOH 3 2003 2003 HOH HOH A . E 4 HOH 4 2004 2004 HOH HOH A . E 4 HOH 5 2005 2005 HOH HOH A . E 4 HOH 6 2006 2006 HOH HOH A . E 4 HOH 7 2007 2007 HOH HOH A . E 4 HOH 8 2008 2008 HOH HOH A . E 4 HOH 9 2009 2009 HOH HOH A . E 4 HOH 10 2010 2010 HOH HOH A . E 4 HOH 11 2011 2011 HOH HOH A . E 4 HOH 12 2012 2012 HOH HOH A . E 4 HOH 13 2013 2013 HOH HOH A . E 4 HOH 14 2014 2014 HOH HOH A . E 4 HOH 15 2015 2015 HOH HOH A . E 4 HOH 16 2016 2016 HOH HOH A . E 4 HOH 17 2017 2017 HOH HOH A . E 4 HOH 18 2018 2018 HOH HOH A . E 4 HOH 19 2019 2019 HOH HOH A . E 4 HOH 20 2020 2020 HOH HOH A . E 4 HOH 21 2021 2021 HOH HOH A . E 4 HOH 22 2022 2022 HOH HOH A . E 4 HOH 23 2023 2023 HOH HOH A . E 4 HOH 24 2024 2024 HOH HOH A . E 4 HOH 25 2025 2025 HOH HOH A . E 4 HOH 26 2026 2026 HOH HOH A . E 4 HOH 27 2027 2027 HOH HOH A . E 4 HOH 28 2028 2028 HOH HOH A . E 4 HOH 29 2029 2029 HOH HOH A . E 4 HOH 30 2030 2030 HOH HOH A . E 4 HOH 31 2031 2031 HOH HOH A . E 4 HOH 32 2032 2032 HOH HOH A . E 4 HOH 33 2033 2033 HOH HOH A . E 4 HOH 34 2034 2034 HOH HOH A . E 4 HOH 35 2035 2035 HOH HOH A . E 4 HOH 36 2036 2036 HOH HOH A . E 4 HOH 37 2037 2037 HOH HOH A . E 4 HOH 38 2038 2038 HOH HOH A . E 4 HOH 39 2039 2039 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 77.4390000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id XE _pdbx_struct_special_symmetry.auth_seq_id 1087 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id XE _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-05 2 'Structure model' 1 1 2015-03-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Non-polymer description' 5 2 'Structure model' Other 6 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_entry_details.entry_id 1W53 _pdbx_entry_details.compound_details 'CATALYTIC ACTIVITY: PHOSPHOSERINE + H2O = SERINE + PHOSPHATE.' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 4 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 8 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.86 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CB A TYR 84 ? ? 1_555 CE2 A TYR 84 ? ? 4_556 2.04 2 1 O A HOH 2013 ? ? 1_555 O A HOH 2013 ? ? 3_656 2.06 3 1 CG A MET 1 ? ? 1_555 OD2 A ASP 65 ? ? 8_456 2.15 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 8 ? B CD A GLU 8 ? ? 2.332 1.515 0.817 0.015 N 2 1 CG A GLN 13 ? ? CD A GLN 13 ? ? 1.314 1.506 -0.192 0.023 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A MET 1 ? ? CB A MET 1 ? ? CG A MET 1 ? ? 143.54 113.30 30.24 1.70 N 2 1 CB A GLU 8 ? B CG A GLU 8 ? B CD A GLU 8 ? ? 76.38 114.20 -37.82 2.70 N 3 1 CG A GLU 8 ? B CD A GLU 8 ? ? OE1 A GLU 8 ? ? 146.93 118.30 28.63 2.00 N 4 1 CG A GLU 8 ? B CD A GLU 8 ? ? OE2 A GLU 8 ? ? 78.51 118.30 -39.79 2.00 N 5 1 CB A GLN 13 ? ? CG A GLN 13 ? ? CD A GLN 13 ? ? 139.67 111.60 28.07 2.60 N 6 1 CG A MET 77 ? ? SD A MET 77 ? ? CE A MET 77 ? ? 88.77 100.20 -11.43 1.60 N # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLU _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 8 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.119 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A MET 1 ? CG ? A MET 1 CG 2 1 Y 0 A MET 1 ? SD ? A MET 1 SD 3 1 Y 0 A MET 1 ? CE ? A MET 1 CE 4 1 Y 0 A GLN 13 ? CD ? A GLN 13 CD 5 1 Y 0 A GLN 13 ? OE1 ? A GLN 13 OE1 6 1 Y 0 A GLN 13 ? NE2 ? A GLN 13 NE2 7 1 Y 0 A GLU 24 ? CD ? A GLU 24 CD 8 1 Y 0 A GLU 24 ? OE1 ? A GLU 24 OE1 9 1 Y 0 A GLU 24 ? OE2 ? A GLU 24 OE2 10 1 Y 0 A ARG 35 ? CD ? A ARG 35 CD 11 1 Y 0 A ARG 35 ? NE ? A ARG 35 NE 12 1 Y 0 A ARG 35 ? CZ ? A ARG 35 CZ 13 1 Y 0 A ARG 35 ? NH1 ? A ARG 35 NH1 14 1 Y 0 A ARG 35 ? NH2 ? A ARG 35 NH2 15 1 Y 0 A TYR 84 ? CG ? A TYR 84 CG 16 1 Y 0 A TYR 84 ? CD1 ? A TYR 84 CD1 17 1 Y 0 A TYR 84 ? CD2 ? A TYR 84 CD2 18 1 Y 0 A TYR 84 ? CE1 ? A TYR 84 CE1 19 1 Y 0 A TYR 84 ? CE2 ? A TYR 84 CE2 20 1 Y 0 A TYR 84 ? CZ ? A TYR 84 CZ 21 1 Y 0 A TYR 84 ? OH ? A TYR 84 OH # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 XENON XE 4 water HOH #