data_1W6V # _entry.id 1W6V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1W6V pdb_00001w6v 10.2210/pdb1w6v/pdb PDBE EBI-20880 ? ? WWPDB D_1290020880 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-12 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_mr' 4 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1W6V _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-08-24 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'De Jong, R.D.' 1 'Ab, E.' 2 'Diercks, T.' 3 'Truffault, V.' 4 'Daniels, M.' 5 'Kaptein, R.' 6 'Folkers, G.E.' 7 # _citation.id primary _citation.title 'Solution Structure of the Human Ubiquitin-Specific Protease 15 Dusp Domain.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 281 _citation.page_first 5026 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16298993 _citation.pdbx_database_id_DOI 10.1074/JBC.M510993200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'De Jong, R.N.' 1 ? primary 'Ab, E.' 2 ? primary 'Diercks, T.' 3 ? primary 'Truffault, V.' 4 ? primary 'Daniels, M.' 5 ? primary 'Kaptein, R.' 6 ? primary 'Folkers, G.E.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15' _entity.formula_weight 16149.077 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.2.15 _entity.pdbx_mutation ? _entity.pdbx_fragment 'DUSP DOMAIN, RESIDUES 1-120' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UBIQUITIN THIOLESTERASE 15, UBIQUITIN-SPECIFIC PROCESSING PROTEASE 15, UBIQUITINATING ENZYME 15, UNPH-2, UNPH4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMMAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN VYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMMAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN VYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 MET n 1 23 ALA n 1 24 GLU n 1 25 GLY n 1 26 GLY n 1 27 ALA n 1 28 ALA n 1 29 ASP n 1 30 LEU n 1 31 ASP n 1 32 THR n 1 33 GLN n 1 34 ARG n 1 35 SER n 1 36 ASP n 1 37 ILE n 1 38 ALA n 1 39 THR n 1 40 LEU n 1 41 LEU n 1 42 LYS n 1 43 THR n 1 44 SER n 1 45 LEU n 1 46 ARG n 1 47 LYS n 1 48 GLY n 1 49 ASP n 1 50 THR n 1 51 TRP n 1 52 TYR n 1 53 LEU n 1 54 VAL n 1 55 ASP n 1 56 SER n 1 57 ARG n 1 58 TRP n 1 59 PHE n 1 60 LYS n 1 61 GLN n 1 62 TRP n 1 63 LYS n 1 64 LYS n 1 65 TYR n 1 66 VAL n 1 67 GLY n 1 68 PHE n 1 69 ASP n 1 70 SER n 1 71 TRP n 1 72 ASP n 1 73 LYS n 1 74 TYR n 1 75 GLN n 1 76 MET n 1 77 GLY n 1 78 ASP n 1 79 GLN n 1 80 ASN n 1 81 VAL n 1 82 TYR n 1 83 PRO n 1 84 GLY n 1 85 PRO n 1 86 ILE n 1 87 ASP n 1 88 ASN n 1 89 SER n 1 90 GLY n 1 91 LEU n 1 92 LEU n 1 93 LYS n 1 94 ASP n 1 95 GLY n 1 96 ASP n 1 97 ALA n 1 98 GLN n 1 99 SER n 1 100 LEU n 1 101 LYS n 1 102 GLU n 1 103 HIS n 1 104 LEU n 1 105 ILE n 1 106 ASP n 1 107 GLU n 1 108 LEU n 1 109 ASP n 1 110 TYR n 1 111 ILE n 1 112 LEU n 1 113 LEU n 1 114 PRO n 1 115 THR n 1 116 GLU n 1 117 GLY n 1 118 TRP n 1 119 ASN n 1 120 LYS n 1 121 LEU n 1 122 VAL n 1 123 SER n 1 124 TRP n 1 125 TYR n 1 126 THR n 1 127 LEU n 1 128 MET n 1 129 GLU n 1 130 GLY n 1 131 GLN n 1 132 GLU n 1 133 PRO n 1 134 ILE n 1 135 ALA n 1 136 ARG n 1 137 LYS n 1 138 VAL n 1 139 VAL n 1 140 GLU n 1 141 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'SELF MADE CDNA LIBRARY OF MULTIPLE HUMAN CARCINOMA CELL LINES' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 SER 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 HIS 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 SER 12 -10 ? ? ? A . n A 1 13 GLY 13 -9 ? ? ? A . n A 1 14 LEU 14 -8 ? ? ? A . n A 1 15 VAL 15 -7 ? ? ? A . n A 1 16 PRO 16 -6 ? ? ? A . n A 1 17 ARG 17 -5 ? ? ? A . n A 1 18 GLY 18 -4 ? ? ? A . n A 1 19 SER 19 -3 ? ? ? A . n A 1 20 HIS 20 -2 ? ? ? A . n A 1 21 MET 21 -1 ? ? ? A . n A 1 22 MET 22 1 1 MET MET A . n A 1 23 ALA 23 2 2 ALA ALA A . n A 1 24 GLU 24 3 3 GLU GLU A . n A 1 25 GLY 25 4 4 GLY GLY A . n A 1 26 GLY 26 5 5 GLY GLY A . n A 1 27 ALA 27 6 6 ALA ALA A . n A 1 28 ALA 28 7 7 ALA ALA A . n A 1 29 ASP 29 8 8 ASP ASP A . n A 1 30 LEU 30 9 9 LEU LEU A . n A 1 31 ASP 31 10 10 ASP ASP A . n A 1 32 THR 32 11 11 THR THR A . n A 1 33 GLN 33 12 12 GLN GLN A . n A 1 34 ARG 34 13 13 ARG ARG A . n A 1 35 SER 35 14 14 SER SER A . n A 1 36 ASP 36 15 15 ASP ASP A . n A 1 37 ILE 37 16 16 ILE ILE A . n A 1 38 ALA 38 17 17 ALA ALA A . n A 1 39 THR 39 18 18 THR THR A . n A 1 40 LEU 40 19 19 LEU LEU A . n A 1 41 LEU 41 20 20 LEU LEU A . n A 1 42 LYS 42 21 21 LYS LYS A . n A 1 43 THR 43 22 22 THR THR A . n A 1 44 SER 44 23 23 SER SER A . n A 1 45 LEU 45 24 24 LEU LEU A . n A 1 46 ARG 46 25 25 ARG ARG A . n A 1 47 LYS 47 26 26 LYS LYS A . n A 1 48 GLY 48 27 27 GLY GLY A . n A 1 49 ASP 49 28 28 ASP ASP A . n A 1 50 THR 50 29 29 THR THR A . n A 1 51 TRP 51 30 30 TRP TRP A . n A 1 52 TYR 52 31 31 TYR TYR A . n A 1 53 LEU 53 32 32 LEU LEU A . n A 1 54 VAL 54 33 33 VAL VAL A . n A 1 55 ASP 55 34 34 ASP ASP A . n A 1 56 SER 56 35 35 SER SER A . n A 1 57 ARG 57 36 36 ARG ARG A . n A 1 58 TRP 58 37 37 TRP TRP A . n A 1 59 PHE 59 38 38 PHE PHE A . n A 1 60 LYS 60 39 39 LYS LYS A . n A 1 61 GLN 61 40 40 GLN GLN A . n A 1 62 TRP 62 41 41 TRP TRP A . n A 1 63 LYS 63 42 42 LYS LYS A . n A 1 64 LYS 64 43 43 LYS LYS A . n A 1 65 TYR 65 44 44 TYR TYR A . n A 1 66 VAL 66 45 45 VAL VAL A . n A 1 67 GLY 67 46 46 GLY GLY A . n A 1 68 PHE 68 47 47 PHE PHE A . n A 1 69 ASP 69 48 48 ASP ASP A . n A 1 70 SER 70 49 49 SER SER A . n A 1 71 TRP 71 50 50 TRP TRP A . n A 1 72 ASP 72 51 51 ASP ASP A . n A 1 73 LYS 73 52 52 LYS LYS A . n A 1 74 TYR 74 53 53 TYR TYR A . n A 1 75 GLN 75 54 54 GLN GLN A . n A 1 76 MET 76 55 55 MET MET A . n A 1 77 GLY 77 56 56 GLY GLY A . n A 1 78 ASP 78 57 57 ASP ASP A . n A 1 79 GLN 79 58 58 GLN GLN A . n A 1 80 ASN 80 59 59 ASN ASN A . n A 1 81 VAL 81 60 60 VAL VAL A . n A 1 82 TYR 82 61 61 TYR TYR A . n A 1 83 PRO 83 62 62 PRO PRO A . n A 1 84 GLY 84 63 63 GLY GLY A . n A 1 85 PRO 85 64 64 PRO PRO A . n A 1 86 ILE 86 65 65 ILE ILE A . n A 1 87 ASP 87 66 66 ASP ASP A . n A 1 88 ASN 88 67 67 ASN ASN A . n A 1 89 SER 89 68 68 SER SER A . n A 1 90 GLY 90 69 69 GLY GLY A . n A 1 91 LEU 91 70 70 LEU LEU A . n A 1 92 LEU 92 71 71 LEU LEU A . n A 1 93 LYS 93 72 72 LYS LYS A . n A 1 94 ASP 94 73 73 ASP ASP A . n A 1 95 GLY 95 74 74 GLY GLY A . n A 1 96 ASP 96 75 75 ASP ASP A . n A 1 97 ALA 97 76 76 ALA ALA A . n A 1 98 GLN 98 77 77 GLN GLN A . n A 1 99 SER 99 78 78 SER SER A . n A 1 100 LEU 100 79 79 LEU LEU A . n A 1 101 LYS 101 80 80 LYS LYS A . n A 1 102 GLU 102 81 81 GLU GLU A . n A 1 103 HIS 103 82 82 HIS HIS A . n A 1 104 LEU 104 83 83 LEU LEU A . n A 1 105 ILE 105 84 84 ILE ILE A . n A 1 106 ASP 106 85 85 ASP ASP A . n A 1 107 GLU 107 86 86 GLU GLU A . n A 1 108 LEU 108 87 87 LEU LEU A . n A 1 109 ASP 109 88 88 ASP ASP A . n A 1 110 TYR 110 89 89 TYR TYR A . n A 1 111 ILE 111 90 90 ILE ILE A . n A 1 112 LEU 112 91 91 LEU LEU A . n A 1 113 LEU 113 92 92 LEU LEU A . n A 1 114 PRO 114 93 93 PRO PRO A . n A 1 115 THR 115 94 94 THR THR A . n A 1 116 GLU 116 95 95 GLU GLU A . n A 1 117 GLY 117 96 96 GLY GLY A . n A 1 118 TRP 118 97 97 TRP TRP A . n A 1 119 ASN 119 98 98 ASN ASN A . n A 1 120 LYS 120 99 99 LYS LYS A . n A 1 121 LEU 121 100 100 LEU LEU A . n A 1 122 VAL 122 101 101 VAL VAL A . n A 1 123 SER 123 102 102 SER SER A . n A 1 124 TRP 124 103 103 TRP TRP A . n A 1 125 TYR 125 104 104 TYR TYR A . n A 1 126 THR 126 105 105 THR THR A . n A 1 127 LEU 127 106 106 LEU LEU A . n A 1 128 MET 128 107 107 MET MET A . n A 1 129 GLU 129 108 108 GLU GLU A . n A 1 130 GLY 130 109 109 GLY GLY A . n A 1 131 GLN 131 110 110 GLN GLN A . n A 1 132 GLU 132 111 111 GLU GLU A . n A 1 133 PRO 133 112 112 PRO PRO A . n A 1 134 ILE 134 113 113 ILE ILE A . n A 1 135 ALA 135 114 114 ALA ALA A . n A 1 136 ARG 136 115 115 ARG ARG A . n A 1 137 LYS 137 116 116 LYS LYS A . n A 1 138 VAL 138 117 117 VAL VAL A . n A 1 139 VAL 139 118 118 VAL VAL A . n A 1 140 GLU 140 119 119 GLU GLU A . n A 1 141 GLN 141 120 120 GLN GLN A . n # _cell.entry_id 1W6V _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1W6V _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1W6V _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1W6V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1W6V _struct.title 'Solution structure of the DUSP domain of hUSP15' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1W6V _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;HYDROLASE, UCH, USP, DUB, DEUBIQUITYLATION, DEUBIQUITINATING ENZYME, UBIQUITIN, UBIQUITIN SPECIFIC PROTEASE, UBIQUITIN CARBOXYTERMINAL HYDROLASE, CLEAVAGE, USP15, DUB15, UBP15, ENDOPEPTIDASE, THIOLESTERASE, DUSP, STRUCTURAL PROTEOMICS IN EUROPE, SPINE, STRUCTURAL GENOMICS ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1W6V 1 ? ? 1W6V ? 2 UNP UB15_HUMAN 1 ? ? Q9Y4E8 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1W6V A 1 ? 21 ? 1W6V -21 ? -1 ? -21 -1 2 2 1W6V A 22 ? 141 ? Q9Y4E8 1 ? 120 ? 1 120 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 29 ? LYS A 42 ? ASP A 8 LYS A 21 1 ? 14 HELX_P HELX_P2 2 SER A 56 ? GLY A 67 ? SER A 35 GLY A 46 1 ? 12 HELX_P HELX_P3 3 PRO A 114 ? TYR A 125 ? PRO A 93 TYR A 104 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 TYR A 110 ? LEU A 113 ? TYR A 89 LEU A 92 AA 2 THR A 50 ? ASP A 55 ? THR A 29 ASP A 34 AA 3 ALA A 135 ? LYS A 137 ? ALA A 114 LYS A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LEU A 113 ? N LEU A 92 O TYR A 52 ? O TYR A 31 AA 2 3 N TRP A 51 ? N TRP A 30 O ARG A 136 ? O ARG A 115 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HZ2 A LYS 43 ? ? OD1 A ASP 51 ? ? 1.59 2 6 OD2 A ASP 15 ? ? HZ1 A LYS 99 ? ? 1.60 3 9 H3 A MET 1 ? ? OE2 A GLU 3 ? ? 1.57 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 13 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LYS _pdbx_validate_rmsd_angle.auth_seq_id_1 52 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LYS _pdbx_validate_rmsd_angle.auth_seq_id_2 52 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CB _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LYS _pdbx_validate_rmsd_angle.auth_seq_id_3 52 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 97.95 _pdbx_validate_rmsd_angle.angle_target_value 110.60 _pdbx_validate_rmsd_angle.angle_deviation -12.65 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.80 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? 60.05 103.11 2 1 ALA A 6 ? ? 70.80 -168.93 3 1 ARG A 25 ? ? 63.67 112.01 4 1 ASP A 85 ? ? -57.12 -151.82 5 1 GLU A 86 ? ? -39.24 -17.81 6 1 THR A 105 ? ? 48.24 -173.27 7 2 LYS A 52 ? ? -142.33 18.77 8 2 ALA A 76 ? ? 58.22 13.59 9 2 ASP A 85 ? ? -59.64 -139.52 10 2 GLU A 86 ? ? -41.44 -18.82 11 2 THR A 105 ? ? 58.30 167.28 12 3 ARG A 25 ? ? -104.88 -157.45 13 3 LYS A 52 ? ? -162.39 9.68 14 3 ASP A 85 ? ? -62.87 -139.08 15 3 THR A 105 ? ? 56.64 172.00 16 3 VAL A 117 ? ? -66.71 -172.11 17 4 ARG A 25 ? ? -127.23 -145.52 18 4 THR A 29 ? ? 49.55 110.20 19 4 LYS A 52 ? ? -156.91 21.41 20 4 ASP A 85 ? ? -61.59 -139.98 21 4 GLU A 86 ? ? -40.33 -18.86 22 4 THR A 105 ? ? 49.63 -174.58 23 5 ARG A 25 ? ? -104.59 -159.55 24 5 LYS A 52 ? ? -157.50 15.47 25 5 LYS A 72 ? ? -64.22 -176.95 26 5 ASP A 85 ? ? -62.55 -146.22 27 5 GLU A 86 ? ? -40.74 -18.19 28 5 THR A 105 ? ? 50.62 -174.11 29 5 VAL A 117 ? ? -60.40 -176.85 30 6 GLU A 3 ? ? 58.88 85.84 31 6 LYS A 26 ? ? -67.90 95.19 32 6 ASP A 51 ? ? -103.37 78.62 33 6 LYS A 52 ? ? -169.92 3.55 34 6 MET A 55 ? ? -58.69 109.17 35 6 TYR A 61 ? ? -34.34 100.47 36 6 ASP A 85 ? ? -60.62 -130.53 37 6 GLU A 86 ? ? -47.51 -17.39 38 6 THR A 105 ? ? 56.33 174.63 39 7 ALA A 6 ? ? 56.43 -158.30 40 7 ARG A 25 ? ? -105.51 -144.68 41 7 LYS A 52 ? ? -145.93 16.31 42 7 SER A 68 ? ? -79.67 24.57 43 7 LYS A 72 ? ? -74.64 -167.87 44 7 ASP A 85 ? ? -71.54 -134.53 45 7 GLU A 86 ? ? -45.53 -19.41 46 7 THR A 105 ? ? 57.77 168.37 47 8 GLU A 3 ? ? 70.25 107.00 48 8 LYS A 72 ? ? -69.90 -169.32 49 8 ASP A 85 ? ? -64.59 -141.15 50 8 GLU A 86 ? ? -40.88 -19.90 51 8 THR A 105 ? ? 53.63 -174.44 52 9 ALA A 2 ? ? -149.61 31.96 53 9 ASP A 51 ? ? -129.26 -94.34 54 9 LYS A 52 ? ? 42.80 29.11 55 9 MET A 55 ? ? -57.00 108.26 56 9 ASP A 85 ? ? -64.87 -130.72 57 9 GLU A 86 ? ? -38.43 -24.08 58 9 THR A 105 ? ? 47.28 -170.05 59 10 LYS A 52 ? ? -160.50 13.05 60 10 TYR A 61 ? ? -33.73 102.38 61 10 ASP A 73 ? ? -84.98 35.30 62 10 ASP A 85 ? ? -56.24 -142.56 63 10 GLU A 86 ? ? -39.09 -19.03 64 10 THR A 105 ? ? 52.74 175.10 65 11 ALA A 2 ? ? 69.66 147.48 66 11 LYS A 26 ? ? -66.12 97.03 67 11 ASP A 75 ? ? 72.16 -49.49 68 11 ASP A 85 ? ? -63.83 -145.14 69 11 GLU A 86 ? ? -40.63 -17.69 70 11 THR A 105 ? ? 50.02 -173.46 71 12 ALA A 6 ? ? 66.24 64.42 72 12 ALA A 7 ? ? 73.52 155.34 73 12 THR A 22 ? ? -46.31 167.29 74 12 ARG A 25 ? ? 60.17 -152.67 75 12 ASP A 85 ? ? -64.39 -110.87 76 12 THR A 105 ? ? 49.63 -176.50 77 13 ASP A 51 ? ? -150.18 73.15 78 13 LYS A 52 ? ? -142.57 13.89 79 13 ASP A 85 ? ? -67.95 -142.03 80 13 GLU A 86 ? ? -40.53 -18.62 81 13 THR A 105 ? ? 54.29 174.87 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 ARG A 13 ? ? 0.072 'SIDE CHAIN' 2 6 ARG A 13 ? ? 0.173 'SIDE CHAIN' 3 9 ARG A 13 ? ? 0.072 'SIDE CHAIN' 4 9 ARG A 115 ? ? 0.077 'SIDE CHAIN' 5 10 ARG A 36 ? ? 0.072 'SIDE CHAIN' 6 11 ARG A 13 ? ? 0.184 'SIDE CHAIN' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ; HELIX DETERMINATION METHOD: AUTHOR PROVIDED. ; # _pdbx_entry_details.entry_id 1W6V _pdbx_entry_details.compound_details ;CATALYTIC ACTIVITY: UBIQUITIN C-TERMINAL THIOLESTER + H(2)O = UBIQUITIN + A THIOL. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.entry_id 1W6V _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 13 _pdbx_nmr_ensemble.conformer_selection_criteria 'SMALLEST MAXIMUM RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 1W6V _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HNCO 1 2 1 HNCACO 1 3 1 HNCACB 1 4 1 CBCACONH 1 5 1 HNCA 1 6 1 HBHACONH 1 7 1 HNCAHA 1 8 1 CCH-COSY 1 9 1 HCCH-TOCSY 1 10 1 HNH-NOESY 1 11 1 HCH-NOESY 1 12 1 'CNH- NOESY' 1 13 1 HH-NOESY 1 # _pdbx_nmr_details.entry_id 1W6V _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 15N- AND 13C, 15N-LABELED HIS-TAGGED HUSP15_1-120' # _pdbx_nmr_refine.entry_id 1W6V _pdbx_nmr_refine.method 'CANDID IN CYANA AND CNS FOR WATER REFINEMENT' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? BRUNGER 1 'structure solution' Sparky ? ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A SER -18 ? A SER 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A HIS -12 ? A HIS 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A SER -10 ? A SER 12 13 1 Y 1 A GLY -9 ? A GLY 13 14 1 Y 1 A LEU -8 ? A LEU 14 15 1 Y 1 A VAL -7 ? A VAL 15 16 1 Y 1 A PRO -6 ? A PRO 16 17 1 Y 1 A ARG -5 ? A ARG 17 18 1 Y 1 A GLY -4 ? A GLY 18 19 1 Y 1 A SER -3 ? A SER 19 20 1 Y 1 A HIS -2 ? A HIS 20 21 1 Y 1 A MET -1 ? A MET 21 22 2 Y 1 A MET -21 ? A MET 1 23 2 Y 1 A GLY -20 ? A GLY 2 24 2 Y 1 A SER -19 ? A SER 3 25 2 Y 1 A SER -18 ? A SER 4 26 2 Y 1 A HIS -17 ? A HIS 5 27 2 Y 1 A HIS -16 ? A HIS 6 28 2 Y 1 A HIS -15 ? A HIS 7 29 2 Y 1 A HIS -14 ? A HIS 8 30 2 Y 1 A HIS -13 ? A HIS 9 31 2 Y 1 A HIS -12 ? A HIS 10 32 2 Y 1 A SER -11 ? A SER 11 33 2 Y 1 A SER -10 ? A SER 12 34 2 Y 1 A GLY -9 ? A GLY 13 35 2 Y 1 A LEU -8 ? A LEU 14 36 2 Y 1 A VAL -7 ? A VAL 15 37 2 Y 1 A PRO -6 ? A PRO 16 38 2 Y 1 A ARG -5 ? A ARG 17 39 2 Y 1 A GLY -4 ? A GLY 18 40 2 Y 1 A SER -3 ? A SER 19 41 2 Y 1 A HIS -2 ? A HIS 20 42 2 Y 1 A MET -1 ? A MET 21 43 3 Y 1 A MET -21 ? A MET 1 44 3 Y 1 A GLY -20 ? A GLY 2 45 3 Y 1 A SER -19 ? A SER 3 46 3 Y 1 A SER -18 ? A SER 4 47 3 Y 1 A HIS -17 ? A HIS 5 48 3 Y 1 A HIS -16 ? A HIS 6 49 3 Y 1 A HIS -15 ? A HIS 7 50 3 Y 1 A HIS -14 ? A HIS 8 51 3 Y 1 A HIS -13 ? A HIS 9 52 3 Y 1 A HIS -12 ? A HIS 10 53 3 Y 1 A SER -11 ? A SER 11 54 3 Y 1 A SER -10 ? A SER 12 55 3 Y 1 A GLY -9 ? A GLY 13 56 3 Y 1 A LEU -8 ? A LEU 14 57 3 Y 1 A VAL -7 ? A VAL 15 58 3 Y 1 A PRO -6 ? A PRO 16 59 3 Y 1 A ARG -5 ? A ARG 17 60 3 Y 1 A GLY -4 ? A GLY 18 61 3 Y 1 A SER -3 ? A SER 19 62 3 Y 1 A HIS -2 ? A HIS 20 63 3 Y 1 A MET -1 ? A MET 21 64 4 Y 1 A MET -21 ? A MET 1 65 4 Y 1 A GLY -20 ? A GLY 2 66 4 Y 1 A SER -19 ? A SER 3 67 4 Y 1 A SER -18 ? A SER 4 68 4 Y 1 A HIS -17 ? A HIS 5 69 4 Y 1 A HIS -16 ? A HIS 6 70 4 Y 1 A HIS -15 ? A HIS 7 71 4 Y 1 A HIS -14 ? A HIS 8 72 4 Y 1 A HIS -13 ? A HIS 9 73 4 Y 1 A HIS -12 ? A HIS 10 74 4 Y 1 A SER -11 ? A SER 11 75 4 Y 1 A SER -10 ? A SER 12 76 4 Y 1 A GLY -9 ? A GLY 13 77 4 Y 1 A LEU -8 ? A LEU 14 78 4 Y 1 A VAL -7 ? A VAL 15 79 4 Y 1 A PRO -6 ? A PRO 16 80 4 Y 1 A ARG -5 ? A ARG 17 81 4 Y 1 A GLY -4 ? A GLY 18 82 4 Y 1 A SER -3 ? A SER 19 83 4 Y 1 A HIS -2 ? A HIS 20 84 4 Y 1 A MET -1 ? A MET 21 85 5 Y 1 A MET -21 ? A MET 1 86 5 Y 1 A GLY -20 ? A GLY 2 87 5 Y 1 A SER -19 ? A SER 3 88 5 Y 1 A SER -18 ? A SER 4 89 5 Y 1 A HIS -17 ? A HIS 5 90 5 Y 1 A HIS -16 ? A HIS 6 91 5 Y 1 A HIS -15 ? A HIS 7 92 5 Y 1 A HIS -14 ? A HIS 8 93 5 Y 1 A HIS -13 ? A HIS 9 94 5 Y 1 A HIS -12 ? A HIS 10 95 5 Y 1 A SER -11 ? A SER 11 96 5 Y 1 A SER -10 ? A SER 12 97 5 Y 1 A GLY -9 ? A GLY 13 98 5 Y 1 A LEU -8 ? A LEU 14 99 5 Y 1 A VAL -7 ? A VAL 15 100 5 Y 1 A PRO -6 ? A PRO 16 101 5 Y 1 A ARG -5 ? A ARG 17 102 5 Y 1 A GLY -4 ? A GLY 18 103 5 Y 1 A SER -3 ? A SER 19 104 5 Y 1 A HIS -2 ? A HIS 20 105 5 Y 1 A MET -1 ? A MET 21 106 6 Y 1 A MET -21 ? A MET 1 107 6 Y 1 A GLY -20 ? A GLY 2 108 6 Y 1 A SER -19 ? A SER 3 109 6 Y 1 A SER -18 ? A SER 4 110 6 Y 1 A HIS -17 ? A HIS 5 111 6 Y 1 A HIS -16 ? A HIS 6 112 6 Y 1 A HIS -15 ? A HIS 7 113 6 Y 1 A HIS -14 ? A HIS 8 114 6 Y 1 A HIS -13 ? A HIS 9 115 6 Y 1 A HIS -12 ? A HIS 10 116 6 Y 1 A SER -11 ? A SER 11 117 6 Y 1 A SER -10 ? A SER 12 118 6 Y 1 A GLY -9 ? A GLY 13 119 6 Y 1 A LEU -8 ? A LEU 14 120 6 Y 1 A VAL -7 ? A VAL 15 121 6 Y 1 A PRO -6 ? A PRO 16 122 6 Y 1 A ARG -5 ? A ARG 17 123 6 Y 1 A GLY -4 ? A GLY 18 124 6 Y 1 A SER -3 ? A SER 19 125 6 Y 1 A HIS -2 ? A HIS 20 126 6 Y 1 A MET -1 ? A MET 21 127 7 Y 1 A MET -21 ? A MET 1 128 7 Y 1 A GLY -20 ? A GLY 2 129 7 Y 1 A SER -19 ? A SER 3 130 7 Y 1 A SER -18 ? A SER 4 131 7 Y 1 A HIS -17 ? A HIS 5 132 7 Y 1 A HIS -16 ? A HIS 6 133 7 Y 1 A HIS -15 ? A HIS 7 134 7 Y 1 A HIS -14 ? A HIS 8 135 7 Y 1 A HIS -13 ? A HIS 9 136 7 Y 1 A HIS -12 ? A HIS 10 137 7 Y 1 A SER -11 ? A SER 11 138 7 Y 1 A SER -10 ? A SER 12 139 7 Y 1 A GLY -9 ? A GLY 13 140 7 Y 1 A LEU -8 ? A LEU 14 141 7 Y 1 A VAL -7 ? A VAL 15 142 7 Y 1 A PRO -6 ? A PRO 16 143 7 Y 1 A ARG -5 ? A ARG 17 144 7 Y 1 A GLY -4 ? A GLY 18 145 7 Y 1 A SER -3 ? A SER 19 146 7 Y 1 A HIS -2 ? A HIS 20 147 7 Y 1 A MET -1 ? A MET 21 148 8 Y 1 A MET -21 ? A MET 1 149 8 Y 1 A GLY -20 ? A GLY 2 150 8 Y 1 A SER -19 ? A SER 3 151 8 Y 1 A SER -18 ? A SER 4 152 8 Y 1 A HIS -17 ? A HIS 5 153 8 Y 1 A HIS -16 ? A HIS 6 154 8 Y 1 A HIS -15 ? A HIS 7 155 8 Y 1 A HIS -14 ? A HIS 8 156 8 Y 1 A HIS -13 ? A HIS 9 157 8 Y 1 A HIS -12 ? A HIS 10 158 8 Y 1 A SER -11 ? A SER 11 159 8 Y 1 A SER -10 ? A SER 12 160 8 Y 1 A GLY -9 ? A GLY 13 161 8 Y 1 A LEU -8 ? A LEU 14 162 8 Y 1 A VAL -7 ? A VAL 15 163 8 Y 1 A PRO -6 ? A PRO 16 164 8 Y 1 A ARG -5 ? A ARG 17 165 8 Y 1 A GLY -4 ? A GLY 18 166 8 Y 1 A SER -3 ? A SER 19 167 8 Y 1 A HIS -2 ? A HIS 20 168 8 Y 1 A MET -1 ? A MET 21 169 9 Y 1 A MET -21 ? A MET 1 170 9 Y 1 A GLY -20 ? A GLY 2 171 9 Y 1 A SER -19 ? A SER 3 172 9 Y 1 A SER -18 ? A SER 4 173 9 Y 1 A HIS -17 ? A HIS 5 174 9 Y 1 A HIS -16 ? A HIS 6 175 9 Y 1 A HIS -15 ? A HIS 7 176 9 Y 1 A HIS -14 ? A HIS 8 177 9 Y 1 A HIS -13 ? A HIS 9 178 9 Y 1 A HIS -12 ? A HIS 10 179 9 Y 1 A SER -11 ? A SER 11 180 9 Y 1 A SER -10 ? A SER 12 181 9 Y 1 A GLY -9 ? A GLY 13 182 9 Y 1 A LEU -8 ? A LEU 14 183 9 Y 1 A VAL -7 ? A VAL 15 184 9 Y 1 A PRO -6 ? A PRO 16 185 9 Y 1 A ARG -5 ? A ARG 17 186 9 Y 1 A GLY -4 ? A GLY 18 187 9 Y 1 A SER -3 ? A SER 19 188 9 Y 1 A HIS -2 ? A HIS 20 189 9 Y 1 A MET -1 ? A MET 21 190 10 Y 1 A MET -21 ? A MET 1 191 10 Y 1 A GLY -20 ? A GLY 2 192 10 Y 1 A SER -19 ? A SER 3 193 10 Y 1 A SER -18 ? A SER 4 194 10 Y 1 A HIS -17 ? A HIS 5 195 10 Y 1 A HIS -16 ? A HIS 6 196 10 Y 1 A HIS -15 ? A HIS 7 197 10 Y 1 A HIS -14 ? A HIS 8 198 10 Y 1 A HIS -13 ? A HIS 9 199 10 Y 1 A HIS -12 ? A HIS 10 200 10 Y 1 A SER -11 ? A SER 11 201 10 Y 1 A SER -10 ? A SER 12 202 10 Y 1 A GLY -9 ? A GLY 13 203 10 Y 1 A LEU -8 ? A LEU 14 204 10 Y 1 A VAL -7 ? A VAL 15 205 10 Y 1 A PRO -6 ? A PRO 16 206 10 Y 1 A ARG -5 ? A ARG 17 207 10 Y 1 A GLY -4 ? A GLY 18 208 10 Y 1 A SER -3 ? A SER 19 209 10 Y 1 A HIS -2 ? A HIS 20 210 10 Y 1 A MET -1 ? A MET 21 211 11 Y 1 A MET -21 ? A MET 1 212 11 Y 1 A GLY -20 ? A GLY 2 213 11 Y 1 A SER -19 ? A SER 3 214 11 Y 1 A SER -18 ? A SER 4 215 11 Y 1 A HIS -17 ? A HIS 5 216 11 Y 1 A HIS -16 ? A HIS 6 217 11 Y 1 A HIS -15 ? A HIS 7 218 11 Y 1 A HIS -14 ? A HIS 8 219 11 Y 1 A HIS -13 ? A HIS 9 220 11 Y 1 A HIS -12 ? A HIS 10 221 11 Y 1 A SER -11 ? A SER 11 222 11 Y 1 A SER -10 ? A SER 12 223 11 Y 1 A GLY -9 ? A GLY 13 224 11 Y 1 A LEU -8 ? A LEU 14 225 11 Y 1 A VAL -7 ? A VAL 15 226 11 Y 1 A PRO -6 ? A PRO 16 227 11 Y 1 A ARG -5 ? A ARG 17 228 11 Y 1 A GLY -4 ? A GLY 18 229 11 Y 1 A SER -3 ? A SER 19 230 11 Y 1 A HIS -2 ? A HIS 20 231 11 Y 1 A MET -1 ? A MET 21 232 12 Y 1 A MET -21 ? A MET 1 233 12 Y 1 A GLY -20 ? A GLY 2 234 12 Y 1 A SER -19 ? A SER 3 235 12 Y 1 A SER -18 ? A SER 4 236 12 Y 1 A HIS -17 ? A HIS 5 237 12 Y 1 A HIS -16 ? A HIS 6 238 12 Y 1 A HIS -15 ? A HIS 7 239 12 Y 1 A HIS -14 ? A HIS 8 240 12 Y 1 A HIS -13 ? A HIS 9 241 12 Y 1 A HIS -12 ? A HIS 10 242 12 Y 1 A SER -11 ? A SER 11 243 12 Y 1 A SER -10 ? A SER 12 244 12 Y 1 A GLY -9 ? A GLY 13 245 12 Y 1 A LEU -8 ? A LEU 14 246 12 Y 1 A VAL -7 ? A VAL 15 247 12 Y 1 A PRO -6 ? A PRO 16 248 12 Y 1 A ARG -5 ? A ARG 17 249 12 Y 1 A GLY -4 ? A GLY 18 250 12 Y 1 A SER -3 ? A SER 19 251 12 Y 1 A HIS -2 ? A HIS 20 252 12 Y 1 A MET -1 ? A MET 21 253 13 Y 1 A MET -21 ? A MET 1 254 13 Y 1 A GLY -20 ? A GLY 2 255 13 Y 1 A SER -19 ? A SER 3 256 13 Y 1 A SER -18 ? A SER 4 257 13 Y 1 A HIS -17 ? A HIS 5 258 13 Y 1 A HIS -16 ? A HIS 6 259 13 Y 1 A HIS -15 ? A HIS 7 260 13 Y 1 A HIS -14 ? A HIS 8 261 13 Y 1 A HIS -13 ? A HIS 9 262 13 Y 1 A HIS -12 ? A HIS 10 263 13 Y 1 A SER -11 ? A SER 11 264 13 Y 1 A SER -10 ? A SER 12 265 13 Y 1 A GLY -9 ? A GLY 13 266 13 Y 1 A LEU -8 ? A LEU 14 267 13 Y 1 A VAL -7 ? A VAL 15 268 13 Y 1 A PRO -6 ? A PRO 16 269 13 Y 1 A ARG -5 ? A ARG 17 270 13 Y 1 A GLY -4 ? A GLY 18 271 13 Y 1 A SER -3 ? A SER 19 272 13 Y 1 A HIS -2 ? A HIS 20 273 13 Y 1 A MET -1 ? A MET 21 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 # _atom_sites.entry_id 1W6V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_