data_1WCR # _entry.id 1WCR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1WCR PDBE EBI-21734 WWPDB D_1290021734 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WCR _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-11-19 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tang, C.' 1 'Clore, G.M.' 2 # _citation.id primary _citation.title ;Solution Structure of Enzyme Iiachitobiose from the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransferase System ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 11770 _citation.page_last ? _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15654077 _citation.pdbx_database_id_DOI 10.1074/JBC.M414300200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Tang, C.' 1 primary 'Williams, D.C.' 2 primary 'Ghirlando, R.' 3 primary 'Clore, G.M.' 4 # _cell.entry_id 1WCR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 3 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WCR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description ;PTS SYSTEM, N, N'-DIACETYLCHITOBIOSE-SPECIFIC IIA COMPONENT ; _entity.formula_weight 11256.186 _entity.pdbx_number_of_molecules 3 _entity.pdbx_ec 2.7.1.69 _entity.pdbx_mutation YES _entity.pdbx_fragment 'RESIDUES 14-116' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;EIIA-CHB, N, N'-DIACETYLCHITOBIOSE-PERMEASE IIA COMPONENT, PHOSPHOTRANSFERASE ENZYME II A COMPONENT, EIII-CHB ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLH LMTSMLARELITELIELHEKLKA ; _entity_poly.pdbx_seq_one_letter_code_can ;AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLH LMTSMLARELITELIELHEKLKA ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 GLU n 1 7 VAL n 1 8 VAL n 1 9 MET n 1 10 GLY n 1 11 LEU n 1 12 ILE n 1 13 ILE n 1 14 ASN n 1 15 SER n 1 16 GLY n 1 17 GLN n 1 18 ALA n 1 19 ARG n 1 20 SER n 1 21 LEU n 1 22 ALA n 1 23 TYR n 1 24 ALA n 1 25 ALA n 1 26 LEU n 1 27 LYS n 1 28 GLN n 1 29 ALA n 1 30 LYS n 1 31 GLN n 1 32 GLY n 1 33 ASP n 1 34 PHE n 1 35 ALA n 1 36 ALA n 1 37 ALA n 1 38 LYS n 1 39 ALA n 1 40 MET n 1 41 MET n 1 42 ASP n 1 43 GLN n 1 44 SER n 1 45 ARG n 1 46 MET n 1 47 ALA n 1 48 LEU n 1 49 ASN n 1 50 GLU n 1 51 ALA n 1 52 HIS n 1 53 LEU n 1 54 VAL n 1 55 GLN n 1 56 THR n 1 57 LYS n 1 58 LEU n 1 59 ILE n 1 60 GLU n 1 61 GLY n 1 62 ASP n 1 63 ALA n 1 64 GLY n 1 65 GLU n 1 66 GLY n 1 67 LYS n 1 68 MET n 1 69 LYS n 1 70 VAL n 1 71 SER n 1 72 LEU n 1 73 VAL n 1 74 LEU n 1 75 VAL n 1 76 HIS n 1 77 ALA n 1 78 GLN n 1 79 LEU n 1 80 HIS n 1 81 LEU n 1 82 MET n 1 83 THR n 1 84 SER n 1 85 MET n 1 86 LEU n 1 87 ALA n 1 88 ARG n 1 89 GLU n 1 90 LEU n 1 91 ILE n 1 92 THR n 1 93 GLU n 1 94 LEU n 1 95 ILE n 1 96 GLU n 1 97 LEU n 1 98 HIS n 1 99 GLU n 1 100 LYS n 1 101 LEU n 1 102 LYS n 1 103 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTCA_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P17335 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1WCR A 1 ? 103 ? P17335 14 ? 116 ? 1 103 2 1 1WCR B 1 ? 103 ? P17335 14 ? 116 ? 1 103 3 1 1WCR C 1 ? 103 ? P17335 14 ? 116 ? 1 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WCR LEU A 79 ? UNP P17335 ASP 92 'engineered mutation' 79 1 2 1WCR LEU B 79 ? UNP P17335 ASP 92 'engineered mutation' 79 2 3 1WCR LEU C 79 ? UNP P17335 ASP 92 'engineered mutation' 79 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '(1) TROSY TRIPLE RESONANCE FOR ASSIGNMENT OF PROTEIN' 1 2 1 '(2) QUANTITATIVE J CORRELATION FOR SIDECHAIN COUPLING CONSTANTS' 1 3 1 '(3) 3D' 1 4 1 '4D HETERONUCLEAR SEPARATED NOE EXPTS' 1 5 1 '(4) TROSY HNCO AND HN(CO)CA EXPERIMENTS FOR DIPOLAR COUPLINGS. DIPOLAR COUPLINGS WERE MEASURED IN PF1 PHAGE' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10MM SODIUM PHOSPHATE' _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DMX Bruker 500 2 DMX Bruker 600 3 DRX Bruker 600 4 DMX Bruker 750 5 DRX Bruker 800 # _pdbx_nmr_refine.entry_id 1WCR _pdbx_nmr_refine.method 'SIMULATED ANNEALING IN TORSION ANG SPACE' _pdbx_nmr_refine.details ;THE TARGET FUNCTION COMPRISES TERMS FOR THE NOE-DERIVED INTERPROTON DISTANCE RESTRAINTS, TORSION ANGLE RESTRAINTS, 13CALPHA/BETA CHEMICAL SHIFT RESTRAINTS, AND RESIDUAL DIPOLAR COUPLING RESTRAINTS (N-H, N-C' AND C'-CA). NON-BONDED INTERACTIONS ARE REPRESENTED BY A QUARTIC VAN DER WAALS REPULSION TERM, TORSION ANGLE AND HYDROGEN BONDING DATABASE POTENTIALS OF MEAN FORCE, AND A RADIUS OF GYRATION RESTRAINT. IN THIS ENTRY THE LAST COLUMN REPRESENTS THE AVERAGE ATOMIC RMS DIFFERENCE IN ANGSTROMS BETWEEN THE 80 INDIVIDUAL SIMULATED ANNEALING STRUCTURES AND THE MEAN COORDINATES RESIDUES 1-3, 61-69 AND 102-103 ARE DISORDERED IN SOLUTION. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1WCR _pdbx_nmr_details.text ;EXPERIMENTAL RESTRAINTS: 1290 INTERPROTON DISTANCE RESTRAINTS: 246 SEQUENTIAL, 258 MEDIUM-RANGE, 90 LONG-RANGE INTRAMOLECULAR RESTRAINTS; 234 INTERMOLECULAR DISTANCE RESTRAINTS; 462 DISTANCE RESTRAINTS FOR BACKBONE H-BONDS FOR 231 H-BONDS (71 PER SUBUNIT) 729 TORSION ANGLE RESTRAINTS (255 PHI, 255 PSI, 219 CHI) 585 CALPHA/CBETA CHEMICAL SHIFT RESTRAINTS 759 RESIDUAL DIPOLAR COUPLING RESTRAINTS (252 N-H, 255 N-C', 249 C'-CA) DIPOLAR COUPLING R-FACTORS FOR THE RESTRAINED REGULARIZED MEAN STRUCTURE N-H 7.1% N-C' 15.2% C'-CA 17.7% ; # _pdbx_nmr_ensemble.entry_id 1WCR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'RESTRAINED REGULARIZED MEAN STRUCTURE' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement 'XPLOR-NIH (HTTP://NMR.CIT.NIH.GOV/XPLOR_NIH) (HTTP://NMR.CIT.NIH.GOV/XPLOR_NIH)' '(HTTP://NMR.CIT.NIH.GOV/XPLOR_NIH)' 'SCHWIETERS, KUSZEWSKI, TJ' 1 'structure solution' XPLOR-NIH ? ? 2 # _exptl.entry_id 1WCR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WCR _struct.title ;Trimeric Structure of the Enzyme IIA from Escherichia coli Phosphotransferase System Specific for N,N'-Diacetylchitobiose ; _struct.pdbx_descriptor ;PTS SYSTEM, N, N'-DIACETYLCHITOBIOSE-SPECIFIC IIA COMPONENT (E.C.2.7.1.69) ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 1WCR _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'IIA, PTS, MUTAGENESIS, CHITOBIOSE, TRANSFERASE, SUGAR TRANSPORT, PHOSPHOTRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 1 ? GLN A 31 ? ALA A 1 GLN A 31 1 ? 31 HELX_P HELX_P2 2 ASP A 33 ? ASP A 62 ? ASP A 33 ASP A 62 1 ? 30 HELX_P HELX_P3 3 SER A 71 ? LYS A 102 ? SER A 71 LYS A 102 1 ? 32 HELX_P HELX_P4 4 ALA B 1 ? GLN B 31 ? ALA B 1 GLN B 31 1 ? 31 HELX_P HELX_P5 5 ASP B 33 ? ASP B 62 ? ASP B 33 ASP B 62 1 ? 30 HELX_P HELX_P6 6 SER B 71 ? LYS B 102 ? SER B 71 LYS B 102 1 ? 32 HELX_P HELX_P7 7 ALA C 1 ? GLN C 31 ? ALA C 1 GLN C 31 1 ? 31 HELX_P HELX_P8 8 ASP C 33 ? ASP C 62 ? ASP C 33 ASP C 62 1 ? 30 HELX_P HELX_P9 9 SER C 71 ? LEU C 101 ? SER C 71 LEU C 101 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1WCR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WCR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n B 1 1 ALA 1 1 1 ALA ALA B . n B 1 2 GLU 2 2 2 GLU GLU B . n B 1 3 GLU 3 3 3 GLU GLU B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 MET 9 9 9 MET MET B . n B 1 10 GLY 10 10 10 GLY GLY B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 ILE 13 13 13 ILE ILE B . n B 1 14 ASN 14 14 14 ASN ASN B . n B 1 15 SER 15 15 15 SER SER B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 GLN 17 17 17 GLN GLN B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 SER 20 20 20 SER SER B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 TYR 23 23 23 TYR TYR B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 GLN 28 28 28 GLN GLN B . n B 1 29 ALA 29 29 29 ALA ALA B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 GLN 31 31 31 GLN GLN B . n B 1 32 GLY 32 32 32 GLY GLY B . n B 1 33 ASP 33 33 33 ASP ASP B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 ALA 35 35 35 ALA ALA B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 LYS 38 38 38 LYS LYS B . n B 1 39 ALA 39 39 39 ALA ALA B . n B 1 40 MET 40 40 40 MET MET B . n B 1 41 MET 41 41 41 MET MET B . n B 1 42 ASP 42 42 42 ASP ASP B . n B 1 43 GLN 43 43 43 GLN GLN B . n B 1 44 SER 44 44 44 SER SER B . n B 1 45 ARG 45 45 45 ARG ARG B . n B 1 46 MET 46 46 46 MET MET B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 LEU 48 48 48 LEU LEU B . n B 1 49 ASN 49 49 49 ASN ASN B . n B 1 50 GLU 50 50 50 GLU GLU B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 HIS 52 52 52 HIS HIS B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 GLN 55 55 55 GLN GLN B . n B 1 56 THR 56 56 56 THR THR B . n B 1 57 LYS 57 57 57 LYS LYS B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 GLY 61 61 61 GLY GLY B . n B 1 62 ASP 62 62 62 ASP ASP B . n B 1 63 ALA 63 63 63 ALA ALA B . n B 1 64 GLY 64 64 64 GLY GLY B . n B 1 65 GLU 65 65 65 GLU GLU B . n B 1 66 GLY 66 66 66 GLY GLY B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 MET 68 68 68 MET MET B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 SER 71 71 71 SER SER B . n B 1 72 LEU 72 72 72 LEU LEU B . n B 1 73 VAL 73 73 73 VAL VAL B . n B 1 74 LEU 74 74 74 LEU LEU B . n B 1 75 VAL 75 75 75 VAL VAL B . n B 1 76 HIS 76 76 76 HIS HIS B . n B 1 77 ALA 77 77 77 ALA ALA B . n B 1 78 GLN 78 78 78 GLN GLN B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 HIS 80 80 80 HIS HIS B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 MET 82 82 82 MET MET B . n B 1 83 THR 83 83 83 THR THR B . n B 1 84 SER 84 84 84 SER SER B . n B 1 85 MET 85 85 85 MET MET B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 ALA 87 87 87 ALA ALA B . n B 1 88 ARG 88 88 88 ARG ARG B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 LEU 90 90 90 LEU LEU B . n B 1 91 ILE 91 91 91 ILE ILE B . n B 1 92 THR 92 92 92 THR THR B . n B 1 93 GLU 93 93 93 GLU GLU B . n B 1 94 LEU 94 94 94 LEU LEU B . n B 1 95 ILE 95 95 95 ILE ILE B . n B 1 96 GLU 96 96 96 GLU GLU B . n B 1 97 LEU 97 97 97 LEU LEU B . n B 1 98 HIS 98 98 98 HIS HIS B . n B 1 99 GLU 99 99 99 GLU GLU B . n B 1 100 LYS 100 100 100 LYS LYS B . n B 1 101 LEU 101 101 101 LEU LEU B . n B 1 102 LYS 102 102 102 LYS LYS B . n B 1 103 ALA 103 103 103 ALA ALA B . n C 1 1 ALA 1 1 1 ALA ALA C . n C 1 2 GLU 2 2 2 GLU GLU C . n C 1 3 GLU 3 3 3 GLU GLU C . n C 1 4 LEU 4 4 4 LEU LEU C . n C 1 5 GLU 5 5 5 GLU GLU C . n C 1 6 GLU 6 6 6 GLU GLU C . n C 1 7 VAL 7 7 7 VAL VAL C . n C 1 8 VAL 8 8 8 VAL VAL C . n C 1 9 MET 9 9 9 MET MET C . n C 1 10 GLY 10 10 10 GLY GLY C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 ILE 12 12 12 ILE ILE C . n C 1 13 ILE 13 13 13 ILE ILE C . n C 1 14 ASN 14 14 14 ASN ASN C . n C 1 15 SER 15 15 15 SER SER C . n C 1 16 GLY 16 16 16 GLY GLY C . n C 1 17 GLN 17 17 17 GLN GLN C . n C 1 18 ALA 18 18 18 ALA ALA C . n C 1 19 ARG 19 19 19 ARG ARG C . n C 1 20 SER 20 20 20 SER SER C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 ALA 22 22 22 ALA ALA C . n C 1 23 TYR 23 23 23 TYR TYR C . n C 1 24 ALA 24 24 24 ALA ALA C . n C 1 25 ALA 25 25 25 ALA ALA C . n C 1 26 LEU 26 26 26 LEU LEU C . n C 1 27 LYS 27 27 27 LYS LYS C . n C 1 28 GLN 28 28 28 GLN GLN C . n C 1 29 ALA 29 29 29 ALA ALA C . n C 1 30 LYS 30 30 30 LYS LYS C . n C 1 31 GLN 31 31 31 GLN GLN C . n C 1 32 GLY 32 32 32 GLY GLY C . n C 1 33 ASP 33 33 33 ASP ASP C . n C 1 34 PHE 34 34 34 PHE PHE C . n C 1 35 ALA 35 35 35 ALA ALA C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 ALA 37 37 37 ALA ALA C . n C 1 38 LYS 38 38 38 LYS LYS C . n C 1 39 ALA 39 39 39 ALA ALA C . n C 1 40 MET 40 40 40 MET MET C . n C 1 41 MET 41 41 41 MET MET C . n C 1 42 ASP 42 42 42 ASP ASP C . n C 1 43 GLN 43 43 43 GLN GLN C . n C 1 44 SER 44 44 44 SER SER C . n C 1 45 ARG 45 45 45 ARG ARG C . n C 1 46 MET 46 46 46 MET MET C . n C 1 47 ALA 47 47 47 ALA ALA C . n C 1 48 LEU 48 48 48 LEU LEU C . n C 1 49 ASN 49 49 49 ASN ASN C . n C 1 50 GLU 50 50 50 GLU GLU C . n C 1 51 ALA 51 51 51 ALA ALA C . n C 1 52 HIS 52 52 52 HIS HIS C . n C 1 53 LEU 53 53 53 LEU LEU C . n C 1 54 VAL 54 54 54 VAL VAL C . n C 1 55 GLN 55 55 55 GLN GLN C . n C 1 56 THR 56 56 56 THR THR C . n C 1 57 LYS 57 57 57 LYS LYS C . n C 1 58 LEU 58 58 58 LEU LEU C . n C 1 59 ILE 59 59 59 ILE ILE C . n C 1 60 GLU 60 60 60 GLU GLU C . n C 1 61 GLY 61 61 61 GLY GLY C . n C 1 62 ASP 62 62 62 ASP ASP C . n C 1 63 ALA 63 63 63 ALA ALA C . n C 1 64 GLY 64 64 64 GLY GLY C . n C 1 65 GLU 65 65 65 GLU GLU C . n C 1 66 GLY 66 66 66 GLY GLY C . n C 1 67 LYS 67 67 67 LYS LYS C . n C 1 68 MET 68 68 68 MET MET C . n C 1 69 LYS 69 69 69 LYS LYS C . n C 1 70 VAL 70 70 70 VAL VAL C . n C 1 71 SER 71 71 71 SER SER C . n C 1 72 LEU 72 72 72 LEU LEU C . n C 1 73 VAL 73 73 73 VAL VAL C . n C 1 74 LEU 74 74 74 LEU LEU C . n C 1 75 VAL 75 75 75 VAL VAL C . n C 1 76 HIS 76 76 76 HIS HIS C . n C 1 77 ALA 77 77 77 ALA ALA C . n C 1 78 GLN 78 78 78 GLN GLN C . n C 1 79 LEU 79 79 79 LEU LEU C . n C 1 80 HIS 80 80 80 HIS HIS C . n C 1 81 LEU 81 81 81 LEU LEU C . n C 1 82 MET 82 82 82 MET MET C . n C 1 83 THR 83 83 83 THR THR C . n C 1 84 SER 84 84 84 SER SER C . n C 1 85 MET 85 85 85 MET MET C . n C 1 86 LEU 86 86 86 LEU LEU C . n C 1 87 ALA 87 87 87 ALA ALA C . n C 1 88 ARG 88 88 88 ARG ARG C . n C 1 89 GLU 89 89 89 GLU GLU C . n C 1 90 LEU 90 90 90 LEU LEU C . n C 1 91 ILE 91 91 91 ILE ILE C . n C 1 92 THR 92 92 92 THR THR C . n C 1 93 GLU 93 93 93 GLU GLU C . n C 1 94 LEU 94 94 94 LEU LEU C . n C 1 95 ILE 95 95 95 ILE ILE C . n C 1 96 GLU 96 96 96 GLU GLU C . n C 1 97 LEU 97 97 97 LEU LEU C . n C 1 98 HIS 98 98 98 HIS HIS C . n C 1 99 GLU 99 99 99 GLU GLU C . n C 1 100 LYS 100 100 100 LYS LYS C . n C 1 101 LEU 101 101 101 LEU LEU C . n C 1 102 LYS 102 102 102 LYS LYS C . n C 1 103 ALA 103 103 103 ALA ALA C . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-19 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_entry_details.entry_id 1WCR _pdbx_entry_details.compound_details 'ENGINEERED RESIDUE ASP 92 LEU (RESIDUE 79 IN COORDINATES).' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B GLU 3 ? ? H B VAL 7 ? ? 1.46 2 1 O C GLU 3 ? ? H C VAL 7 ? ? 1.46 3 1 O A GLU 3 ? ? H A VAL 7 ? ? 1.46 4 1 O A ALA 1 ? ? H A GLU 5 ? ? 1.47 5 1 O C ALA 1 ? ? H C GLU 5 ? ? 1.47 6 1 O B ALA 1 ? ? H B GLU 5 ? ? 1.47 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -25.19 -89.42 2 1 ASP A 62 ? ? -65.83 -86.73 3 1 ALA A 63 ? ? -27.21 107.02 4 1 LYS A 67 ? ? -17.32 142.51 5 1 LYS A 69 ? ? -17.51 -125.49 6 1 LYS A 102 ? ? 147.86 -96.46 7 1 GLU B 2 ? ? -25.38 -89.40 8 1 ASP B 62 ? ? -66.90 -87.65 9 1 ALA B 63 ? ? -28.66 103.31 10 1 LYS B 67 ? ? -17.36 143.47 11 1 LYS B 69 ? ? -17.54 -125.35 12 1 LYS B 102 ? ? 144.06 -99.73 13 1 GLU C 2 ? ? -25.17 -89.44 14 1 ASP C 62 ? ? -66.60 -87.74 15 1 ALA C 63 ? ? -29.11 104.05 16 1 LYS C 67 ? ? -17.37 143.32 17 1 LYS C 69 ? ? -17.16 -125.93 18 1 LYS C 102 ? ? 87.88 -109.35 #