data_1WEE # _entry.id 1WEE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WEE pdb_00001wee 10.2210/pdb1wee/pdb RCSB RCSB023487 ? ? WWPDB D_1000023487 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id atr001000671.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WEE _pdbx_database_status.recvd_initial_deposition_date 2004-05-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of PHD domain in PHD finger family protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHD finger family protein' 7649.585 1 ? ? 'PHD domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier atr001000671.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 GLU n 1 10 ARG n 1 11 GLY n 1 12 VAL n 1 13 ASP n 1 14 ASN n 1 15 TRP n 1 16 LYS n 1 17 VAL n 1 18 ASP n 1 19 CYS n 1 20 LYS n 1 21 CYS n 1 22 GLY n 1 23 THR n 1 24 LYS n 1 25 ASP n 1 26 ASP n 1 27 ASP n 1 28 GLY n 1 29 GLU n 1 30 ARG n 1 31 MET n 1 32 LEU n 1 33 ALA n 1 34 CYS n 1 35 ASP n 1 36 GLY n 1 37 CYS n 1 38 GLY n 1 39 VAL n 1 40 TRP n 1 41 HIS n 1 42 HIS n 1 43 THR n 1 44 ARG n 1 45 CYS n 1 46 ILE n 1 47 GLY n 1 48 ILE n 1 49 ASN n 1 50 ASN n 1 51 ALA n 1 52 ASP n 1 53 ALA n 1 54 LEU n 1 55 PRO n 1 56 SER n 1 57 LYS n 1 58 PHE n 1 59 LEU n 1 60 CYS n 1 61 PHE n 1 62 ARG n 1 63 CYS n 1 64 ILE n 1 65 GLU n 1 66 LEU n 1 67 SER n 1 68 GLY n 1 69 PRO n 1 70 SER n 1 71 SER n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene RAFL09-15-N01 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name L030422-A06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1342_ARATH _struct_ref.pdbx_db_accession Q9C810 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIEL _struct_ref.pdbx_align_begin 595 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WEE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9C810 _struct_ref_seq.db_align_beg 595 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 653 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WEE GLY A 1 ? UNP Q9C810 ? ? 'cloning artifact' 1 1 1 1WEE SER A 2 ? UNP Q9C810 ? ? 'cloning artifact' 2 2 1 1WEE SER A 3 ? UNP Q9C810 ? ? 'cloning artifact' 3 3 1 1WEE GLY A 4 ? UNP Q9C810 ? ? 'cloning artifact' 4 4 1 1WEE SER A 5 ? UNP Q9C810 ? ? 'cloning artifact' 5 5 1 1WEE SER A 6 ? UNP Q9C810 ? ? 'cloning artifact' 6 6 1 1WEE GLY A 7 ? UNP Q9C810 ? ? 'cloning artifact' 7 7 1 1WEE SER A 67 ? UNP Q9C810 ? ? 'cloning artifact' 67 8 1 1WEE GLY A 68 ? UNP Q9C810 ? ? 'cloning artifact' 68 9 1 1WEE PRO A 69 ? UNP Q9C810 ? ? 'cloning artifact' 69 10 1 1WEE SER A 70 ? UNP Q9C810 ? ? 'cloning artifact' 70 11 1 1WEE SER A 71 ? UNP Q9C810 ? ? 'cloning artifact' 71 12 1 1WEE GLY A 72 ? UNP Q9C810 ? ? 'cloning artifact' 72 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15,13C; d-Tris-HCl(pH 7.0); 100mM NaCl; 0.1mM ZnCl2; 1mM NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1WEE _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WEE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WEE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing Delaglio,F. 2 NMRView 5.0.4 'data analysis' Johnson,B.A. 3 KUJIRA 0.863 'data analysis' Cobayashi,N. 4 CYANA 2.0.17 refinement Guentert,P. 5 # _exptl.entry_id 1WEE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WEE _struct.title 'Solution structure of PHD domain in PHD finger family protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WEE _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 43 ? ILE A 46 ? THR A 43 ILE A 46 1 ? 4 HELX_P HELX_P2 2 PHE A 61 ? LEU A 66 ? PHE A 61 LEU A 66 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc3 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc4 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc5 metalc ? ? A HIS 42 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc6 metalc ? ? A CYS 45 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 45 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc7 metalc ? ? A CYS 60 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 60 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc8 metalc ? ? A CYS 63 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 63 A ZN 401 1_555 ? ? ? ? ? ? ? 2.330 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 39 ? HIS A 42 ? VAL A 39 HIS A 42 A 2 MET A 31 ? ALA A 33 ? MET A 31 ALA A 33 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 42 ? HIS A 42 . ? 1_555 ? 4 AC1 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 5 AC2 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 7 AC2 4 CYS A 60 ? CYS A 60 . ? 1_555 ? 8 AC2 4 CYS A 63 ? CYS A 63 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WEE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WEE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 116.0 ? 2 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 42 ? A HIS 42 ? 1_555 109.4 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 42 ? A HIS 42 ? 1_555 115.6 ? 4 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 114.0 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 91.2 ? 6 ND1 ? A HIS 42 ? A HIS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 109.6 ? 7 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 98.0 ? 8 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 117.3 ? 9 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 109.9 ? 10 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 101.5 ? 11 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 118.2 ? 12 SG ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 111.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_sheet 10 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.value' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 23 4 'Structure model' '_struct_ref_seq_dif.details' 24 4 'Structure model' '_struct_sheet.number_strands' 25 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX AUTHOR DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET AUTHOR DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 10 ? ? -174.99 127.32 2 1 ASP A 13 ? ? -59.63 -174.93 3 1 ASN A 14 ? ? -34.23 -74.99 4 1 TRP A 15 ? ? -35.97 113.54 5 1 ASP A 26 ? ? -57.07 101.79 6 1 ASP A 35 ? ? -37.71 -36.01 7 1 SER A 70 ? ? -44.35 100.99 8 2 MET A 8 ? ? 33.08 49.66 9 2 GLU A 9 ? ? -94.94 32.95 10 2 ASP A 13 ? ? -124.87 -71.78 11 2 ALA A 51 ? ? -87.04 38.28 12 2 ASP A 52 ? ? -171.17 123.34 13 3 SER A 6 ? ? -167.20 111.55 14 3 VAL A 12 ? ? -38.27 156.04 15 3 LYS A 16 ? ? -59.75 101.65 16 3 ASP A 27 ? ? -92.65 -65.12 17 3 ASN A 50 ? ? -89.89 43.49 18 3 ILE A 64 ? ? -35.32 -34.63 19 3 PRO A 69 ? ? -69.85 88.52 20 4 TRP A 15 ? ? -57.62 90.24 21 4 LYS A 16 ? ? -63.54 74.83 22 4 ASP A 27 ? ? -93.02 41.64 23 4 HIS A 42 ? ? -65.35 97.93 24 4 ASN A 49 ? ? -55.26 170.23 25 4 ASN A 50 ? ? -85.35 43.20 26 4 ALA A 51 ? ? -131.91 -36.15 27 4 ILE A 64 ? ? -34.27 -35.71 28 4 PRO A 69 ? ? -69.79 93.84 29 5 ASN A 14 ? ? -129.85 -56.44 30 5 TRP A 15 ? ? -39.67 100.21 31 5 LYS A 16 ? ? -68.89 83.92 32 5 ASP A 18 ? ? -49.01 99.87 33 5 LYS A 24 ? ? -93.42 31.50 34 5 CYS A 37 ? ? -60.07 -70.48 35 5 HIS A 42 ? ? -69.25 99.69 36 5 THR A 43 ? ? -38.76 -30.84 37 5 ILE A 48 ? ? -53.78 102.32 38 5 ILE A 64 ? ? -34.03 -36.40 39 6 VAL A 12 ? ? -49.05 174.09 40 6 HIS A 42 ? ? -56.38 107.16 41 6 THR A 43 ? ? -40.00 -38.79 42 6 ILE A 64 ? ? -33.91 -34.99 43 6 SER A 67 ? ? -38.90 146.13 44 6 PRO A 69 ? ? -69.77 90.66 45 7 LYS A 16 ? ? -56.08 102.31 46 7 ASP A 27 ? ? -85.02 40.43 47 7 ILE A 48 ? ? -33.44 150.74 48 7 ALA A 51 ? ? -84.81 38.13 49 7 ASP A 52 ? ? -172.06 145.68 50 8 SER A 5 ? ? 38.46 42.19 51 8 ARG A 10 ? ? -45.39 100.44 52 8 LYS A 16 ? ? -68.01 84.99 53 8 VAL A 17 ? ? -83.04 40.95 54 8 ASP A 35 ? ? -35.29 -38.57 55 8 ILE A 48 ? ? -30.73 144.49 56 8 ASP A 52 ? ? -41.01 158.32 57 8 ILE A 64 ? ? -33.43 -37.78 58 8 SER A 71 ? ? -80.61 44.51 59 9 LYS A 16 ? ? -65.21 78.96 60 9 HIS A 42 ? ? -62.32 88.72 61 9 ASN A 50 ? ? -36.12 -39.86 62 9 ILE A 64 ? ? -36.29 -29.49 63 10 SER A 5 ? ? -48.61 107.44 64 10 GLU A 9 ? ? -81.69 45.21 65 10 ASP A 18 ? ? -172.51 124.02 66 10 ASP A 27 ? ? -104.43 -64.26 67 10 HIS A 42 ? ? -54.52 104.81 68 10 ASP A 52 ? ? -44.46 168.40 69 10 PRO A 69 ? ? -69.77 0.08 70 10 SER A 70 ? ? -47.02 97.22 71 11 SER A 3 ? ? -84.98 47.60 72 11 ASN A 14 ? ? -130.37 -48.13 73 11 LYS A 16 ? ? -60.55 85.49 74 11 CYS A 34 ? ? -59.68 103.06 75 11 ASP A 35 ? ? -34.84 -34.70 76 11 ILE A 48 ? ? -65.08 99.95 77 11 PRO A 69 ? ? -69.77 2.84 78 12 ASN A 14 ? ? -133.77 -69.03 79 12 TRP A 15 ? ? -110.89 -76.30 80 12 ASP A 35 ? ? -35.77 -35.38 81 13 SER A 6 ? ? -174.56 148.39 82 13 MET A 8 ? ? -173.03 146.50 83 13 ASP A 13 ? ? -106.95 -72.53 84 13 ASN A 14 ? ? -34.49 -34.31 85 13 ASP A 27 ? ? -130.28 -49.80 86 13 ASN A 50 ? ? -36.96 -36.27 87 13 ILE A 64 ? ? -34.57 -34.74 88 14 SER A 6 ? ? -39.58 100.97 89 14 VAL A 12 ? ? -37.15 144.09 90 14 CYS A 37 ? ? -76.10 -70.83 91 14 ALA A 51 ? ? -87.08 31.93 92 14 ASP A 52 ? ? -175.13 149.63 93 14 CYS A 60 ? ? -46.47 157.76 94 14 PHE A 61 ? ? -33.37 -72.60 95 14 SER A 67 ? ? -37.80 100.82 96 14 PRO A 69 ? ? -69.74 10.83 97 14 SER A 70 ? ? -79.75 45.28 98 14 SER A 71 ? ? -172.00 145.49 99 15 CYS A 63 ? ? -38.48 -70.62 100 15 ILE A 64 ? ? -33.03 -35.89 101 16 SER A 3 ? ? -39.32 117.81 102 16 MET A 8 ? ? -108.42 42.69 103 16 ARG A 10 ? ? -84.62 48.01 104 16 VAL A 17 ? ? -55.68 81.99 105 16 ASP A 35 ? ? -34.09 -38.05 106 16 HIS A 42 ? ? -47.21 101.08 107 16 THR A 43 ? ? -37.25 -35.87 108 16 ILE A 48 ? ? -30.51 142.23 109 16 CYS A 60 ? ? -43.78 152.68 110 16 PRO A 69 ? ? -69.70 99.05 111 17 ASN A 50 ? ? -81.82 46.07 112 17 ALA A 51 ? ? -130.83 -41.79 113 17 ALA A 53 ? ? -49.57 169.32 114 17 ILE A 64 ? ? -37.56 -32.78 115 18 MET A 8 ? ? -43.91 99.82 116 18 GLU A 9 ? ? -48.07 104.97 117 18 ILE A 48 ? ? -27.58 140.36 118 18 ASN A 50 ? ? 35.54 31.11 119 18 ALA A 53 ? ? -64.11 -179.68 120 18 ILE A 64 ? ? -34.46 -33.17 121 19 SER A 2 ? ? 39.88 42.19 122 19 SER A 6 ? ? -36.24 114.87 123 19 ARG A 10 ? ? -174.02 140.78 124 19 VAL A 17 ? ? 31.19 37.50 125 19 ARG A 30 ? ? -44.67 160.86 126 19 ASP A 35 ? ? -34.78 -37.47 127 19 HIS A 42 ? ? -58.96 101.28 128 19 ILE A 48 ? ? -38.19 138.54 129 20 VAL A 17 ? ? -117.26 71.01 130 20 ASP A 26 ? ? -58.65 96.68 131 20 HIS A 42 ? ? -55.62 105.62 132 20 ILE A 48 ? ? -29.26 97.53 133 20 ASP A 52 ? ? -48.29 170.75 134 20 PHE A 61 ? ? -33.84 -38.13 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #