data_1WEN
# 
_entry.id   1WEN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1WEN         pdb_00001wen 10.2210/pdb1wen/pdb 
RCSB  RCSB023495   ?            ?                   
WWPDB D_1000023495 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-25 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2024-05-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_2             
2  4 'Structure model' pdbx_nmr_software      
3  4 'Structure model' pdbx_nmr_spectrometer  
4  4 'Structure model' pdbx_struct_assembly   
5  4 'Structure model' pdbx_struct_conn_angle 
6  4 'Structure model' pdbx_struct_oper_list  
7  4 'Structure model' struct_conn            
8  4 'Structure model' struct_ref_seq_dif     
9  4 'Structure model' struct_site            
10 5 'Structure model' chem_comp_atom         
11 5 'Structure model' chem_comp_bond         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                       
2  4 'Structure model' '_database_2.pdbx_database_accession'        
3  4 'Structure model' '_pdbx_nmr_software.name'                    
4  4 'Structure model' '_pdbx_nmr_spectrometer.model'               
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'  
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'  
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.value'              
10 4 'Structure model' '_struct_conn.pdbx_dist_value'               
11 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'            
12 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'             
13 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'           
14 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'           
15 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'           
16 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'            
17 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'            
18 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'             
19 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'           
20 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'           
21 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'           
22 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'            
23 4 'Structure model' '_struct_ref_seq_dif.details'                
24 4 'Structure model' '_struct_site.pdbx_auth_asym_id'             
25 4 'Structure model' '_struct_site.pdbx_auth_comp_id'             
26 4 'Structure model' '_struct_site.pdbx_auth_seq_id'              
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WEN 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-25 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          mmt007014689.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, F.'                                                 1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Shirouzu, M.'                                           5 
'Terada, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of PHD domain in ING1-like protein BAC25079' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'He, F.'       1 ? 
primary 'Muto, Y.'     2 ? 
primary 'Inoue, M.'    3 ? 
primary 'Kigawa, T.'   4 ? 
primary 'Shirouzu, M.' 5 ? 
primary 'Terada, T.'   6 ? 
primary 'Yokoyama, S.' 7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'inhibitor of growth family, member 4; ING1-like protein' 7641.465 1 ? ? 'PHD domain' ? 
2 non-polymer syn 'ZINC ION'                                                65.409   2 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ING1-like protein BAC25079' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         mmt007014689.1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  ASP n 
1 9  MET n 
1 10 PRO n 
1 11 VAL n 
1 12 ASP n 
1 13 PRO n 
1 14 ASN n 
1 15 GLU n 
1 16 PRO n 
1 17 THR n 
1 18 TYR n 
1 19 CYS n 
1 20 LEU n 
1 21 CYS n 
1 22 HIS n 
1 23 GLN n 
1 24 VAL n 
1 25 SER n 
1 26 TYR n 
1 27 GLY n 
1 28 GLU n 
1 29 MET n 
1 30 ILE n 
1 31 GLY n 
1 32 CYS n 
1 33 ASP n 
1 34 ASN n 
1 35 PRO n 
1 36 ASP n 
1 37 CYS n 
1 38 SER n 
1 39 ILE n 
1 40 GLU n 
1 41 TRP n 
1 42 PHE n 
1 43 HIS n 
1 44 PHE n 
1 45 ALA n 
1 46 CYS n 
1 47 VAL n 
1 48 GLY n 
1 49 LEU n 
1 50 THR n 
1 51 THR n 
1 52 LYS n 
1 53 PRO n 
1 54 ARG n 
1 55 GLY n 
1 56 LYS n 
1 57 TRP n 
1 58 PHE n 
1 59 CYS n 
1 60 PRO n 
1 61 ARG n 
1 62 CYS n 
1 63 SER n 
1 64 GLN n 
1 65 GLU n 
1 66 SER n 
1 67 GLY n 
1 68 PRO n 
1 69 SER n 
1 70 SER n 
1 71 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 'RIKEN cDNA 1110062A16' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P030408-71 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell free protein synthesis' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  SER 3  3  3  SER SER A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  SER 6  6  6  SER SER A . n 
A 1 7  GLY 7  7  7  GLY GLY A . n 
A 1 8  ASP 8  8  8  ASP ASP A . n 
A 1 9  MET 9  9  9  MET MET A . n 
A 1 10 PRO 10 10 10 PRO PRO A . n 
A 1 11 VAL 11 11 11 VAL VAL A . n 
A 1 12 ASP 12 12 12 ASP ASP A . n 
A 1 13 PRO 13 13 13 PRO PRO A . n 
A 1 14 ASN 14 14 14 ASN ASN A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 PRO 16 16 16 PRO PRO A . n 
A 1 17 THR 17 17 17 THR THR A . n 
A 1 18 TYR 18 18 18 TYR TYR A . n 
A 1 19 CYS 19 19 19 CYS CYS A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 CYS 21 21 21 CYS CYS A . n 
A 1 22 HIS 22 22 22 HIS HIS A . n 
A 1 23 GLN 23 23 23 GLN GLN A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 SER 25 25 25 SER SER A . n 
A 1 26 TYR 26 26 26 TYR TYR A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 GLU 28 28 28 GLU GLU A . n 
A 1 29 MET 29 29 29 MET MET A . n 
A 1 30 ILE 30 30 30 ILE ILE A . n 
A 1 31 GLY 31 31 31 GLY GLY A . n 
A 1 32 CYS 32 32 32 CYS CYS A . n 
A 1 33 ASP 33 33 33 ASP ASP A . n 
A 1 34 ASN 34 34 34 ASN ASN A . n 
A 1 35 PRO 35 35 35 PRO PRO A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 CYS 37 37 37 CYS CYS A . n 
A 1 38 SER 38 38 38 SER SER A . n 
A 1 39 ILE 39 39 39 ILE ILE A . n 
A 1 40 GLU 40 40 40 GLU GLU A . n 
A 1 41 TRP 41 41 41 TRP TRP A . n 
A 1 42 PHE 42 42 42 PHE PHE A . n 
A 1 43 HIS 43 43 43 HIS HIS A . n 
A 1 44 PHE 44 44 44 PHE PHE A . n 
A 1 45 ALA 45 45 45 ALA ALA A . n 
A 1 46 CYS 46 46 46 CYS CYS A . n 
A 1 47 VAL 47 47 47 VAL VAL A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 LEU 49 49 49 LEU LEU A . n 
A 1 50 THR 50 50 50 THR THR A . n 
A 1 51 THR 51 51 51 THR THR A . n 
A 1 52 LYS 52 52 52 LYS LYS A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 ARG 54 54 54 ARG ARG A . n 
A 1 55 GLY 55 55 55 GLY GLY A . n 
A 1 56 LYS 56 56 56 LYS LYS A . n 
A 1 57 TRP 57 57 57 TRP TRP A . n 
A 1 58 PHE 58 58 58 PHE PHE A . n 
A 1 59 CYS 59 59 59 CYS CYS A . n 
A 1 60 PRO 60 60 60 PRO PRO A . n 
A 1 61 ARG 61 61 61 ARG ARG A . n 
A 1 62 CYS 62 62 62 CYS CYS A . n 
A 1 63 SER 63 63 63 SER SER A . n 
A 1 64 GLN 64 64 64 GLN GLN A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 SER 66 66 66 SER SER A . n 
A 1 67 GLY 67 67 67 GLY GLY A . n 
A 1 68 PRO 68 68 68 PRO PRO A . n 
A 1 69 SER 69 69 69 SER SER A . n 
A 1 70 SER 70 70 70 SER SER A . n 
A 1 71 GLY 71 71 71 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN 1 201 201 ZN ZN A . 
C 2 ZN 1 401 401 ZN ZN A . 
# 
_exptl.entry_id          1WEN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1WEN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1WEN 
_struct.title                     'Solution structure of PHD domain in ING1-like protein BAC25079' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WEN 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
'structural genomics, PHD domain, ING1-like protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ING4_MOUSE 
_struct_ref.pdbx_db_accession          Q8C0D7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   DMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQE 
_struct_ref.pdbx_align_begin           187 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WEN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 65 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8C0D7 
_struct_ref_seq.db_align_beg                  187 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  244 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       65 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WEN GLY A 1  ? UNP Q8C0D7 ? ? 'cloning artifact' 1  1  
1 1WEN SER A 2  ? UNP Q8C0D7 ? ? 'cloning artifact' 2  2  
1 1WEN SER A 3  ? UNP Q8C0D7 ? ? 'cloning artifact' 3  3  
1 1WEN GLY A 4  ? UNP Q8C0D7 ? ? 'cloning artifact' 4  4  
1 1WEN SER A 5  ? UNP Q8C0D7 ? ? 'cloning artifact' 5  5  
1 1WEN SER A 6  ? UNP Q8C0D7 ? ? 'cloning artifact' 6  6  
1 1WEN GLY A 7  ? UNP Q8C0D7 ? ? 'cloning artifact' 7  7  
1 1WEN SER A 66 ? UNP Q8C0D7 ? ? 'cloning artifact' 66 8  
1 1WEN GLY A 67 ? UNP Q8C0D7 ? ? 'cloning artifact' 67 9  
1 1WEN PRO A 68 ? UNP Q8C0D7 ? ? 'cloning artifact' 68 10 
1 1WEN SER A 69 ? UNP Q8C0D7 ? ? 'cloning artifact' 69 11 
1 1WEN SER A 70 ? UNP Q8C0D7 ? ? 'cloning artifact' 70 12 
1 1WEN GLY A 71 ? UNP Q8C0D7 ? ? 'cloning artifact' 71 13 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 44 ? VAL A 47 ? PHE A 44 VAL A 47 1 ? 4 
HELX_P HELX_P2 2 PRO A 60 ? GLN A 64 ? PRO A 60 GLN A 64 1 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 19 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc2 metalc ? ? A CYS 21 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc3 metalc ? ? A CYS 32 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 401 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc4 metalc ? ? A CYS 37 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc5 metalc ? ? A HIS 43 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 43 A ZN 201 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc6 metalc ? ? A CYS 46 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 46 A ZN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc7 metalc ? ? A CYS 59 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 59 A ZN 401 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc8 metalc ? ? A CYS 62 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 62 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 21 ? A CYS 21 ? 1_555 117.3 ? 
2  SG  ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 101.3 ? 
3  SG  ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 118.2 ? 
4  SG  ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 46 ? A CYS 46 ? 1_555 116.6 ? 
5  SG  ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 46 ? A CYS 46 ? 1_555 86.9  ? 
6  ND1 ? A HIS 43 ? A HIS 43 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 46 ? A CYS 46 ? 1_555 117.5 ? 
7  SG  ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 37 ? A CYS 37 ? 1_555 113.7 ? 
8  SG  ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 59 ? A CYS 59 ? 1_555 118.8 ? 
9  SG  ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 59 ? A CYS 59 ? 1_555 118.5 ? 
10 SG  ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 62 ? A CYS 62 ? 1_555 118.5 ? 
11 SG  ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 62 ? A CYS 62 ? 1_555 95.0  ? 
12 SG  ? A CYS 59 ? A CYS 59 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 62 ? A CYS 62 ? 1_555 86.8  ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 29 ? ILE A 30 ? MET A 29 ILE A 30 
A 2 PHE A 42 ? HIS A 43 ? PHE A 42 HIS A 43 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    30 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     30 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    42 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     42 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 
2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 
3 AC1 4 HIS A 43 ? HIS A 43 . ? 1_555 ? 
4 AC1 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 
5 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 
6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 
7 AC2 4 CYS A 59 ? CYS A 59 . ? 1_555 ? 
8 AC2 4 CYS A 62 ? CYS A 62 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  SER A 5  ? ? -34.82  123.91  
2   1  VAL A 11 ? ? -51.64  175.83  
3   1  PRO A 13 ? ? -69.74  2.27    
4   1  TYR A 18 ? ? -127.72 -75.28  
5   1  CYS A 21 ? ? -49.92  -17.99  
6   1  CYS A 37 ? ? -39.47  129.89  
7   1  PHE A 44 ? ? -52.61  -70.75  
8   1  ALA A 45 ? ? -38.33  -31.73  
9   1  VAL A 47 ? ? -83.19  35.01   
10  1  PRO A 60 ? ? -69.79  7.15    
11  1  SER A 69 ? ? -45.52  97.55   
12  2  MET A 9  ? ? -34.35  130.43  
13  2  PRO A 10 ? ? -69.74  -178.66 
14  2  TYR A 18 ? ? -104.98 -70.91  
15  2  CYS A 19 ? ? -39.76  160.65  
16  2  CYS A 32 ? ? -45.71  155.71  
17  2  CYS A 37 ? ? -39.69  126.00  
18  2  VAL A 47 ? ? -83.40  34.43   
19  2  CYS A 59 ? ? -48.68  153.91  
20  2  PRO A 60 ? ? -69.79  4.20    
21  2  GLN A 64 ? ? -94.96  49.71   
22  3  ASP A 8  ? ? -35.07  145.63  
23  3  MET A 9  ? ? -37.26  99.86   
24  3  CYS A 19 ? ? -45.82  160.70  
25  3  SER A 25 ? ? -44.37  101.61  
26  3  ASP A 33 ? ? -97.39  30.20   
27  3  VAL A 47 ? ? -84.52  31.68   
28  3  CYS A 59 ? ? -48.43  153.85  
29  3  PRO A 60 ? ? -69.81  5.18    
30  3  GLN A 64 ? ? -81.77  40.58   
31  4  MET A 9  ? ? -41.35  152.18  
32  4  VAL A 11 ? ? -56.31  178.37  
33  4  TYR A 18 ? ? -131.30 -74.62  
34  4  SER A 25 ? ? -66.31  98.89   
35  4  CYS A 32 ? ? -37.59  135.87  
36  4  VAL A 47 ? ? -81.54  36.97   
37  4  CYS A 59 ? ? -43.71  155.70  
38  4  PRO A 60 ? ? -69.76  3.80    
39  4  PRO A 68 ? ? -69.74  86.51   
40  5  TYR A 18 ? ? -109.83 -69.91  
41  5  CYS A 19 ? ? -44.65  165.63  
42  5  CYS A 32 ? ? -38.16  134.04  
43  5  CYS A 37 ? ? -36.16  124.31  
44  5  GLU A 40 ? ? 36.36   37.42   
45  5  TRP A 41 ? ? -165.58 112.67  
46  5  VAL A 47 ? ? -84.04  31.22   
47  5  CYS A 59 ? ? -42.44  153.95  
48  5  PRO A 60 ? ? -69.78  4.49    
49  5  GLN A 64 ? ? -100.64 75.31   
50  5  SER A 66 ? ? -34.58  103.70  
51  5  PRO A 68 ? ? -69.78  5.44    
52  5  SER A 69 ? ? -32.63  105.19  
53  6  PRO A 10 ? ? -69.72  -174.08 
54  6  TYR A 18 ? ? -117.17 -73.55  
55  6  CYS A 19 ? ? -41.71  162.58  
56  6  CYS A 37 ? ? -39.46  133.68  
57  6  TRP A 41 ? ? -165.75 119.40  
58  6  CYS A 59 ? ? -40.17  154.60  
59  6  PRO A 60 ? ? -69.76  9.05    
60  6  GLN A 64 ? ? -81.12  42.45   
61  6  SER A 70 ? ? -97.07  -61.51  
62  7  SER A 5  ? ? -170.34 124.26  
63  7  CYS A 19 ? ? -43.44  162.58  
64  7  SER A 25 ? ? -56.06  102.77  
65  7  CYS A 32 ? ? -45.93  158.03  
66  7  CYS A 37 ? ? -39.16  134.29  
67  7  PHE A 44 ? ? -37.10  -70.91  
68  7  CYS A 59 ? ? -45.44  155.23  
69  7  PRO A 60 ? ? -69.77  3.98    
70  8  SER A 6  ? ? 34.36   43.74   
71  8  ASP A 8  ? ? -100.46 61.31   
72  8  VAL A 11 ? ? -33.96  146.11  
73  8  PRO A 13 ? ? -69.79  2.84    
74  8  TYR A 18 ? ? -108.65 -70.60  
75  8  CYS A 19 ? ? -40.25  160.54  
76  8  SER A 25 ? ? -48.44  109.95  
77  8  CYS A 32 ? ? -34.79  136.80  
78  8  CYS A 37 ? ? -37.36  114.18  
79  8  TRP A 41 ? ? -169.52 117.67  
80  8  VAL A 47 ? ? -93.04  34.29   
81  8  PRO A 53 ? ? -69.76  96.18   
82  8  CYS A 59 ? ? -47.76  154.53  
83  8  PRO A 60 ? ? -69.78  6.52    
84  8  GLN A 64 ? ? -111.94 76.45   
85  8  PRO A 68 ? ? -69.77  13.18   
86  8  SER A 69 ? ? -28.91  127.01  
87  9  PRO A 10 ? ? -69.74  -175.51 
88  9  TYR A 18 ? ? -102.04 -68.03  
89  9  CYS A 19 ? ? -40.80  159.87  
90  9  SER A 25 ? ? -53.79  102.01  
91  9  CYS A 32 ? ? -39.87  132.10  
92  9  CYS A 37 ? ? -34.75  137.17  
93  9  PRO A 53 ? ? -69.78  99.46   
94  9  PRO A 60 ? ? -69.73  10.26   
95  9  GLN A 64 ? ? -108.12 75.16   
96  10 PRO A 10 ? ? -69.74  88.67   
97  10 PRO A 13 ? ? -69.77  2.86    
98  10 CYS A 19 ? ? -39.73  161.00  
99  10 SER A 25 ? ? -52.30  101.76  
100 10 CYS A 37 ? ? -37.12  119.00  
101 10 GLU A 40 ? ? 35.62   37.08   
102 10 TRP A 41 ? ? -164.76 115.80  
103 10 CYS A 59 ? ? -49.00  154.06  
104 10 PRO A 60 ? ? -69.77  7.02    
105 10 GLN A 64 ? ? -91.66  39.10   
106 10 GLU A 65 ? ? -81.46  42.13   
107 10 SER A 66 ? ? -34.50  151.95  
108 10 PRO A 68 ? ? -69.73  5.55    
109 10 SER A 69 ? ? -66.74  97.53   
110 11 PRO A 10 ? ? -69.78  16.13   
111 11 VAL A 11 ? ? -28.69  135.32  
112 11 GLU A 15 ? ? -49.93  156.18  
113 11 TYR A 18 ? ? -128.18 -68.10  
114 11 CYS A 19 ? ? -41.34  162.24  
115 11 TYR A 26 ? ? -170.25 138.68  
116 11 CYS A 37 ? ? -37.65  110.84  
117 11 CYS A 59 ? ? -38.73  154.29  
118 11 PRO A 60 ? ? -69.76  4.11    
119 11 GLU A 65 ? ? -55.93  103.71  
120 12 VAL A 11 ? ? -43.37  167.71  
121 12 PRO A 13 ? ? -69.81  1.54    
122 12 CYS A 19 ? ? -41.94  162.19  
123 12 SER A 25 ? ? -56.03  101.46  
124 12 CYS A 32 ? ? -36.15  146.31  
125 12 CYS A 37 ? ? -32.84  120.98  
126 12 TRP A 41 ? ? -165.46 118.67  
127 12 VAL A 47 ? ? -92.71  34.17   
128 12 LYS A 56 ? ? -36.51  140.12  
129 12 CYS A 59 ? ? -46.17  155.19  
130 12 PRO A 60 ? ? -69.80  12.03   
131 12 PRO A 68 ? ? -69.83  92.55   
132 13 CYS A 19 ? ? -44.80  164.17  
133 13 CYS A 37 ? ? -36.52  151.43  
134 13 VAL A 47 ? ? -83.18  31.98   
135 13 CYS A 59 ? ? -47.97  154.48  
136 13 GLN A 64 ? ? -81.28  41.16   
137 14 PRO A 10 ? ? -69.74  -174.84 
138 14 VAL A 11 ? ? -52.06  170.87  
139 14 TYR A 18 ? ? -115.74 -70.29  
140 14 CYS A 19 ? ? -40.78  161.91  
141 14 SER A 25 ? ? -57.99  100.02  
142 14 CYS A 32 ? ? -36.02  146.17  
143 14 CYS A 37 ? ? -34.99  111.85  
144 14 TRP A 41 ? ? -169.37 119.30  
145 14 CYS A 59 ? ? -36.72  153.98  
146 14 PRO A 60 ? ? -69.76  13.87   
147 14 SER A 63 ? ? -83.65  33.34   
148 14 SER A 69 ? ? -38.76  130.16  
149 15 PRO A 10 ? ? -69.73  -165.99 
150 15 ASN A 14 ? ? 35.23   31.04   
151 15 TYR A 18 ? ? -122.71 -57.73  
152 15 CYS A 32 ? ? -45.59  156.62  
153 15 CYS A 59 ? ? -38.48  154.49  
154 15 PRO A 60 ? ? -69.73  3.47    
155 15 PRO A 68 ? ? -69.70  -176.62 
156 16 SER A 5  ? ? -170.80 132.59  
157 16 TYR A 18 ? ? -108.42 -71.46  
158 16 CYS A 19 ? ? -44.59  162.06  
159 16 CYS A 32 ? ? -38.50  127.83  
160 16 THR A 50 ? ? 38.27   27.41   
161 16 PRO A 53 ? ? -69.75  86.88   
162 16 PRO A 60 ? ? -69.73  6.70    
163 16 PRO A 68 ? ? -69.79  91.73   
164 17 TYR A 18 ? ? -111.45 -70.67  
165 17 CYS A 19 ? ? -40.94  162.62  
166 17 CYS A 32 ? ? -39.00  153.57  
167 17 LYS A 52 ? ? -39.07  124.33  
168 17 CYS A 59 ? ? -43.98  154.54  
169 17 PRO A 60 ? ? -69.79  4.07    
170 17 GLN A 64 ? ? 31.03   51.98   
171 17 PRO A 68 ? ? -69.69  -170.64 
172 18 GLU A 15 ? ? -45.87  104.48  
173 18 TYR A 18 ? ? -123.64 -62.25  
174 18 CYS A 32 ? ? -34.75  141.27  
175 18 CYS A 37 ? ? -46.75  108.87  
176 18 VAL A 47 ? ? -93.64  32.54   
177 18 CYS A 59 ? ? -38.60  154.80  
178 18 PRO A 60 ? ? -69.78  5.68    
179 18 GLN A 64 ? ? -92.51  41.75   
180 18 PRO A 68 ? ? -69.81  -174.57 
181 18 SER A 69 ? ? -68.03  93.86   
182 19 CYS A 19 ? ? -47.07  162.31  
183 19 LYS A 52 ? ? -34.48  125.44  
184 19 CYS A 59 ? ? -39.44  155.35  
185 19 GLN A 64 ? ? -80.46  44.60   
186 19 PRO A 68 ? ? -69.79  0.37    
187 19 SER A 69 ? ? -33.37  131.93  
188 19 SER A 70 ? ? -94.40  45.75   
189 20 SER A 3  ? ? -174.78 132.48  
190 20 ASP A 8  ? ? -173.80 142.06  
191 20 PRO A 10 ? ? -69.76  6.41    
192 20 CYS A 19 ? ? -40.36  158.86  
193 20 CYS A 32 ? ? -45.42  159.51  
194 20 PHE A 44 ? ? -36.66  -70.67  
195 20 PRO A 53 ? ? -69.75  89.71   
196 20 CYS A 59 ? ? -47.73  155.01  
197 20 PRO A 60 ? ? -69.79  6.97    
198 20 GLN A 64 ? ? -75.85  48.61   
199 20 SER A 69 ? ? 39.37   42.78   
200 20 SER A 70 ? ? -45.89  156.88  
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;HELIX
determination method: author determined
;
# 
_pdbx_nmr_ensemble.entry_id                                      1WEN 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WEN 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.8mM U-15, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 0.1mM ZnCl2; 1mM d-TDD; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 1 1 3D_13C-separated_NOESY 
# 
_pdbx_nmr_refine.entry_id           1WEN 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6      collection           Bruker          1 
NMRPipe 20020425 processing           'Delaglio, F.'  2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
KUJIRA  0.863    'data analysis'      'Cobayashi, N.' 4 
CYANA   2.0.17   'structure solution' 'Guentert, P.'  5 
CYANA   2.0.17   refinement           'Guentert, P.'  6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LEU N    N  N N 180 
LEU CA   C  N S 181 
LEU C    C  N N 182 
LEU O    O  N N 183 
LEU CB   C  N N 184 
LEU CG   C  N N 185 
LEU CD1  C  N N 186 
LEU CD2  C  N N 187 
LEU OXT  O  N N 188 
LEU H    H  N N 189 
LEU H2   H  N N 190 
LEU HA   H  N N 191 
LEU HB2  H  N N 192 
LEU HB3  H  N N 193 
LEU HG   H  N N 194 
LEU HD11 H  N N 195 
LEU HD12 H  N N 196 
LEU HD13 H  N N 197 
LEU HD21 H  N N 198 
LEU HD22 H  N N 199 
LEU HD23 H  N N 200 
LEU HXT  H  N N 201 
LYS N    N  N N 202 
LYS CA   C  N S 203 
LYS C    C  N N 204 
LYS O    O  N N 205 
LYS CB   C  N N 206 
LYS CG   C  N N 207 
LYS CD   C  N N 208 
LYS CE   C  N N 209 
LYS NZ   N  N N 210 
LYS OXT  O  N N 211 
LYS H    H  N N 212 
LYS H2   H  N N 213 
LYS HA   H  N N 214 
LYS HB2  H  N N 215 
LYS HB3  H  N N 216 
LYS HG2  H  N N 217 
LYS HG3  H  N N 218 
LYS HD2  H  N N 219 
LYS HD3  H  N N 220 
LYS HE2  H  N N 221 
LYS HE3  H  N N 222 
LYS HZ1  H  N N 223 
LYS HZ2  H  N N 224 
LYS HZ3  H  N N 225 
LYS HXT  H  N N 226 
MET N    N  N N 227 
MET CA   C  N S 228 
MET C    C  N N 229 
MET O    O  N N 230 
MET CB   C  N N 231 
MET CG   C  N N 232 
MET SD   S  N N 233 
MET CE   C  N N 234 
MET OXT  O  N N 235 
MET H    H  N N 236 
MET H2   H  N N 237 
MET HA   H  N N 238 
MET HB2  H  N N 239 
MET HB3  H  N N 240 
MET HG2  H  N N 241 
MET HG3  H  N N 242 
MET HE1  H  N N 243 
MET HE2  H  N N 244 
MET HE3  H  N N 245 
MET HXT  H  N N 246 
PHE N    N  N N 247 
PHE CA   C  N S 248 
PHE C    C  N N 249 
PHE O    O  N N 250 
PHE CB   C  N N 251 
PHE CG   C  Y N 252 
PHE CD1  C  Y N 253 
PHE CD2  C  Y N 254 
PHE CE1  C  Y N 255 
PHE CE2  C  Y N 256 
PHE CZ   C  Y N 257 
PHE OXT  O  N N 258 
PHE H    H  N N 259 
PHE H2   H  N N 260 
PHE HA   H  N N 261 
PHE HB2  H  N N 262 
PHE HB3  H  N N 263 
PHE HD1  H  N N 264 
PHE HD2  H  N N 265 
PHE HE1  H  N N 266 
PHE HE2  H  N N 267 
PHE HZ   H  N N 268 
PHE HXT  H  N N 269 
PRO N    N  N N 270 
PRO CA   C  N S 271 
PRO C    C  N N 272 
PRO O    O  N N 273 
PRO CB   C  N N 274 
PRO CG   C  N N 275 
PRO CD   C  N N 276 
PRO OXT  O  N N 277 
PRO H    H  N N 278 
PRO HA   H  N N 279 
PRO HB2  H  N N 280 
PRO HB3  H  N N 281 
PRO HG2  H  N N 282 
PRO HG3  H  N N 283 
PRO HD2  H  N N 284 
PRO HD3  H  N N 285 
PRO HXT  H  N N 286 
SER N    N  N N 287 
SER CA   C  N S 288 
SER C    C  N N 289 
SER O    O  N N 290 
SER CB   C  N N 291 
SER OG   O  N N 292 
SER OXT  O  N N 293 
SER H    H  N N 294 
SER H2   H  N N 295 
SER HA   H  N N 296 
SER HB2  H  N N 297 
SER HB3  H  N N 298 
SER HG   H  N N 299 
SER HXT  H  N N 300 
THR N    N  N N 301 
THR CA   C  N S 302 
THR C    C  N N 303 
THR O    O  N N 304 
THR CB   C  N R 305 
THR OG1  O  N N 306 
THR CG2  C  N N 307 
THR OXT  O  N N 308 
THR H    H  N N 309 
THR H2   H  N N 310 
THR HA   H  N N 311 
THR HB   H  N N 312 
THR HG1  H  N N 313 
THR HG21 H  N N 314 
THR HG22 H  N N 315 
THR HG23 H  N N 316 
THR HXT  H  N N 317 
TRP N    N  N N 318 
TRP CA   C  N S 319 
TRP C    C  N N 320 
TRP O    O  N N 321 
TRP CB   C  N N 322 
TRP CG   C  Y N 323 
TRP CD1  C  Y N 324 
TRP CD2  C  Y N 325 
TRP NE1  N  Y N 326 
TRP CE2  C  Y N 327 
TRP CE3  C  Y N 328 
TRP CZ2  C  Y N 329 
TRP CZ3  C  Y N 330 
TRP CH2  C  Y N 331 
TRP OXT  O  N N 332 
TRP H    H  N N 333 
TRP H2   H  N N 334 
TRP HA   H  N N 335 
TRP HB2  H  N N 336 
TRP HB3  H  N N 337 
TRP HD1  H  N N 338 
TRP HE1  H  N N 339 
TRP HE3  H  N N 340 
TRP HZ2  H  N N 341 
TRP HZ3  H  N N 342 
TRP HH2  H  N N 343 
TRP HXT  H  N N 344 
TYR N    N  N N 345 
TYR CA   C  N S 346 
TYR C    C  N N 347 
TYR O    O  N N 348 
TYR CB   C  N N 349 
TYR CG   C  Y N 350 
TYR CD1  C  Y N 351 
TYR CD2  C  Y N 352 
TYR CE1  C  Y N 353 
TYR CE2  C  Y N 354 
TYR CZ   C  Y N 355 
TYR OH   O  N N 356 
TYR OXT  O  N N 357 
TYR H    H  N N 358 
TYR H2   H  N N 359 
TYR HA   H  N N 360 
TYR HB2  H  N N 361 
TYR HB3  H  N N 362 
TYR HD1  H  N N 363 
TYR HD2  H  N N 364 
TYR HE1  H  N N 365 
TYR HE2  H  N N 366 
TYR HH   H  N N 367 
TYR HXT  H  N N 368 
VAL N    N  N N 369 
VAL CA   C  N S 370 
VAL C    C  N N 371 
VAL O    O  N N 372 
VAL CB   C  N N 373 
VAL CG1  C  N N 374 
VAL CG2  C  N N 375 
VAL OXT  O  N N 376 
VAL H    H  N N 377 
VAL H2   H  N N 378 
VAL HA   H  N N 379 
VAL HB   H  N N 380 
VAL HG11 H  N N 381 
VAL HG12 H  N N 382 
VAL HG13 H  N N 383 
VAL HG21 H  N N 384 
VAL HG22 H  N N 385 
VAL HG23 H  N N 386 
VAL HXT  H  N N 387 
ZN  ZN   ZN N N 388 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_atom_sites.entry_id                    1WEN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_