data_1WEO # _entry.id 1WEO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WEO pdb_00001weo 10.2210/pdb1weo/pdb RCSB RCSB023496 ? ? WWPDB D_1000023496 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.value' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 23 4 'Structure model' '_struct_ref_seq_dif.details' 24 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WEO _pdbx_database_status.recvd_initial_deposition_date 2004-05-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id atr001009297.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cellulose synthase, catalytic subunit (IRX3)' 10109.072 1 ? ? RING-finger ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGD EDEEDIDSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGD EDEEDIDSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier atr001009297.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 LYS n 1 10 PRO n 1 11 LEU n 1 12 LYS n 1 13 ASN n 1 14 LEU n 1 15 ASP n 1 16 GLY n 1 17 GLN n 1 18 PHE n 1 19 CYS n 1 20 GLU n 1 21 ILE n 1 22 CYS n 1 23 GLY n 1 24 ASP n 1 25 GLN n 1 26 ILE n 1 27 GLY n 1 28 LEU n 1 29 THR n 1 30 VAL n 1 31 GLU n 1 32 GLY n 1 33 ASP n 1 34 LEU n 1 35 PHE n 1 36 VAL n 1 37 ALA n 1 38 CYS n 1 39 ASN n 1 40 GLU n 1 41 CYS n 1 42 GLY n 1 43 PHE n 1 44 PRO n 1 45 ALA n 1 46 CYS n 1 47 ARG n 1 48 PRO n 1 49 CYS n 1 50 TYR n 1 51 GLU n 1 52 TYR n 1 53 GLU n 1 54 ARG n 1 55 ARG n 1 56 GLU n 1 57 GLY n 1 58 THR n 1 59 GLN n 1 60 ASN n 1 61 CYS n 1 62 PRO n 1 63 GLN n 1 64 CYS n 1 65 LYS n 1 66 THR n 1 67 ARG n 1 68 TYR n 1 69 LYS n 1 70 ARG n 1 71 LEU n 1 72 ARG n 1 73 GLY n 1 74 SER n 1 75 PRO n 1 76 ARG n 1 77 VAL n 1 78 GLU n 1 79 GLY n 1 80 ASP n 1 81 GLU n 1 82 ASP n 1 83 GLU n 1 84 GLU n 1 85 ASP n 1 86 ILE n 1 87 ASP n 1 88 SER n 1 89 GLY n 1 90 PRO n 1 91 SER n 1 92 SER n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene RAFL09-35-F05 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030224-84 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _cell.entry_id 1WEO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WEO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1WEO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WEO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WEO _struct.title 'Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WEO _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;structure genomics, RING-finger, cellulose synthase, catalytic subunit(IRX3), RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CESA7_ARATH _struct_ref.pdbx_db_accession Q9SWW6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDID ; _struct_ref.pdbx_align_begin 26 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WEO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9SWW6 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WEO GLY A 1 ? UNP Q9SWW6 ? ? 'cloning artifact' 1 1 1 1WEO SER A 2 ? UNP Q9SWW6 ? ? 'cloning artifact' 2 2 1 1WEO SER A 3 ? UNP Q9SWW6 ? ? 'cloning artifact' 3 3 1 1WEO GLY A 4 ? UNP Q9SWW6 ? ? 'cloning artifact' 4 4 1 1WEO SER A 5 ? UNP Q9SWW6 ? ? 'cloning artifact' 5 5 1 1WEO SER A 6 ? UNP Q9SWW6 ? ? 'cloning artifact' 6 6 1 1WEO GLY A 7 ? UNP Q9SWW6 ? ? 'cloning artifact' 7 7 1 1WEO SER A 88 ? UNP Q9SWW6 ? ? 'cloning artifact' 88 8 1 1WEO GLY A 89 ? UNP Q9SWW6 ? ? 'cloning artifact' 89 9 1 1WEO PRO A 90 ? UNP Q9SWW6 ? ? 'cloning artifact' 90 10 1 1WEO SER A 91 ? UNP Q9SWW6 ? ? 'cloning artifact' 91 11 1 1WEO SER A 92 ? UNP Q9SWW6 ? ? 'cloning artifact' 92 12 1 1WEO GLY A 93 ? UNP Q9SWW6 ? ? 'cloning artifact' 93 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 55 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 55 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc2 metalc ? ? A CYS 22 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 22 A ZN 201 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc3 metalc ? ? A CYS 38 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 401 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc4 metalc ? ? A CYS 41 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 41 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? A CYS 46 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 46 A ZN 201 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc6 metalc ? ? A CYS 49 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 49 A ZN 201 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc7 metalc ? ? A CYS 61 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 61 A ZN 401 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc8 metalc ? ? A CYS 64 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 64 A ZN 401 1_555 ? ? ? ? ? ? ? 2.370 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 111.8 ? 2 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 118.4 ? 3 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 116.2 ? 4 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 105.3 ? 5 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 116.5 ? 6 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 85.7 ? 7 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 116.4 ? 8 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 61 ? A CYS 61 ? 1_555 111.2 ? 9 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 61 ? A CYS 61 ? 1_555 113.9 ? 10 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 101.6 ? 11 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 115.7 ? 12 SG ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 95.6 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 2 AC1 4 CYS A 22 ? CYS A 22 . ? 1_555 ? 3 AC1 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 4 AC1 4 CYS A 49 ? CYS A 49 . ? 1_555 ? 5 AC2 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 6 AC2 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 7 AC2 4 CYS A 61 ? CYS A 61 . ? 1_555 ? 8 AC2 4 CYS A 64 ? CYS A 64 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 8 ? ? -69.76 -91.11 2 1 LYS A 12 ? ? -34.85 109.46 3 1 CYS A 19 ? ? -45.75 150.93 4 1 ASP A 24 ? ? -34.86 149.72 5 1 ILE A 26 ? ? -52.81 97.19 6 1 THR A 29 ? ? -67.12 -179.52 7 1 PRO A 44 ? ? -69.71 98.78 8 1 CYS A 46 ? ? -57.41 -176.06 9 1 PRO A 48 ? ? -69.81 12.68 10 1 GLU A 53 ? ? -36.97 -31.49 11 1 GLN A 59 ? ? 73.98 36.27 12 1 PRO A 62 ? ? -69.80 4.48 13 1 ARG A 76 ? ? -44.00 152.29 14 1 ILE A 86 ? ? -86.77 32.14 15 1 PRO A 90 ? ? -69.72 88.15 16 2 SER A 6 ? ? -122.64 -51.40 17 2 PRO A 8 ? ? -69.82 -176.46 18 2 LYS A 9 ? ? -35.05 141.75 19 2 PRO A 10 ? ? -69.74 99.92 20 2 GLN A 17 ? ? -34.51 -32.98 21 2 ASP A 24 ? ? -35.18 147.31 22 2 CYS A 46 ? ? -54.73 -177.23 23 2 PRO A 48 ? ? -69.74 15.62 24 2 PRO A 62 ? ? -69.72 2.00 25 2 SER A 74 ? ? -45.51 104.34 26 2 PRO A 75 ? ? -69.76 -169.59 27 2 GLU A 78 ? ? -68.24 -174.82 28 2 ASP A 85 ? ? -103.05 44.55 29 2 PRO A 90 ? ? -69.74 88.00 30 3 SER A 2 ? ? -173.15 137.72 31 3 SER A 6 ? ? -92.04 41.33 32 3 LYS A 12 ? ? -34.20 145.80 33 3 LEU A 14 ? ? -89.64 41.95 34 3 GLN A 17 ? ? -38.72 -29.10 35 3 CYS A 19 ? ? -46.79 150.71 36 3 ASP A 24 ? ? -40.49 161.88 37 3 PHE A 35 ? ? -67.96 99.87 38 3 CYS A 46 ? ? -55.94 -175.59 39 3 PRO A 48 ? ? -69.72 11.26 40 3 PRO A 62 ? ? -69.76 4.49 41 3 SER A 74 ? ? -35.50 100.48 42 3 GLU A 78 ? ? 35.63 41.02 43 3 ASP A 80 ? ? -99.94 -67.95 44 3 GLU A 84 ? ? -35.50 133.19 45 3 ILE A 86 ? ? -33.90 134.17 46 4 PRO A 8 ? ? -69.73 80.28 47 4 GLN A 17 ? ? -38.62 -28.65 48 4 ASP A 24 ? ? -41.51 163.83 49 4 ILE A 26 ? ? -56.80 106.61 50 4 CYS A 46 ? ? -50.52 -179.83 51 4 PRO A 48 ? ? -69.73 17.44 52 4 PRO A 62 ? ? -69.79 3.53 53 4 SER A 74 ? ? -32.24 96.16 54 4 GLU A 78 ? ? -35.17 133.08 55 4 ASP A 87 ? ? -46.83 104.40 56 5 PRO A 10 ? ? -69.80 -179.07 57 5 LEU A 14 ? ? -98.75 40.45 58 5 ASP A 24 ? ? -39.86 160.70 59 5 PHE A 35 ? ? -66.78 93.10 60 5 CYS A 46 ? ? -56.12 -177.45 61 5 PRO A 48 ? ? -69.78 11.82 62 5 PRO A 62 ? ? -69.76 3.51 63 5 GLU A 78 ? ? -56.06 95.90 64 5 ASP A 80 ? ? -41.60 160.81 65 5 PRO A 90 ? ? -69.70 -172.88 66 5 SER A 91 ? ? -94.66 43.17 67 6 GLN A 17 ? ? -36.12 -30.63 68 6 ASP A 24 ? ? -36.85 145.08 69 6 CYS A 46 ? ? -56.63 -175.33 70 6 PRO A 48 ? ? -69.74 14.04 71 6 ARG A 55 ? ? -81.36 -70.84 72 6 PRO A 62 ? ? -69.76 3.63 73 6 SER A 74 ? ? -36.05 111.66 74 6 PRO A 75 ? ? -69.79 -166.47 75 6 GLU A 78 ? ? 36.18 47.92 76 6 PRO A 90 ? ? -69.75 87.28 77 7 GLN A 17 ? ? -39.62 -32.10 78 7 CYS A 19 ? ? -43.84 152.28 79 7 ASP A 24 ? ? -36.11 150.63 80 7 PRO A 48 ? ? -69.77 19.72 81 7 CYS A 49 ? ? -130.41 -34.63 82 7 GLN A 59 ? ? 72.64 42.13 83 7 PRO A 62 ? ? -69.82 3.70 84 7 SER A 74 ? ? -34.10 99.30 85 7 PRO A 75 ? ? -69.75 -166.20 86 7 GLU A 78 ? ? -81.20 40.47 87 7 ASP A 87 ? ? -80.42 49.21 88 7 SER A 92 ? ? 37.04 42.37 89 8 LYS A 12 ? ? -58.95 100.31 90 8 CYS A 19 ? ? -49.46 150.20 91 8 ASP A 24 ? ? -40.41 162.03 92 8 PHE A 35 ? ? -53.49 95.11 93 8 CYS A 46 ? ? -56.36 -174.22 94 8 PRO A 48 ? ? -69.76 10.24 95 8 PRO A 62 ? ? -69.81 3.33 96 8 SER A 74 ? ? -38.22 100.11 97 8 PRO A 75 ? ? -69.71 -169.21 98 8 GLU A 83 ? ? -81.49 43.73 99 8 ASP A 87 ? ? -175.06 146.98 100 9 SER A 2 ? ? -171.84 -179.85 101 9 PRO A 8 ? ? -69.80 -177.75 102 9 LYS A 9 ? ? -39.65 106.50 103 9 LYS A 12 ? ? -37.04 148.36 104 9 GLN A 17 ? ? -36.84 -30.62 105 9 ASP A 24 ? ? -36.35 151.35 106 9 ILE A 26 ? ? -50.93 105.85 107 9 VAL A 30 ? ? -37.66 -39.63 108 9 PHE A 35 ? ? -66.99 88.92 109 9 CYS A 46 ? ? -59.83 -178.73 110 9 PRO A 48 ? ? -69.73 17.19 111 9 PRO A 62 ? ? -69.74 2.22 112 9 GLU A 81 ? ? 46.08 27.11 113 9 ASP A 85 ? ? -65.91 95.88 114 9 SER A 92 ? ? -125.73 -54.46 115 10 PRO A 8 ? ? -69.78 4.15 116 10 ASN A 13 ? ? -35.92 120.36 117 10 GLN A 17 ? ? -36.36 -30.58 118 10 ASP A 24 ? ? -35.53 146.19 119 10 ILE A 26 ? ? -49.75 109.84 120 10 ALA A 37 ? ? -41.10 -70.22 121 10 CYS A 46 ? ? -58.16 -178.04 122 10 PRO A 48 ? ? -69.74 12.92 123 10 PRO A 62 ? ? -69.73 5.22 124 10 SER A 74 ? ? -47.82 105.19 125 10 GLU A 78 ? ? -36.05 123.69 126 10 ASP A 82 ? ? -43.01 155.65 127 10 GLU A 83 ? ? -101.27 41.70 128 11 PRO A 10 ? ? -69.76 -172.86 129 11 ASN A 13 ? ? -45.90 160.55 130 11 LEU A 14 ? ? -88.80 41.34 131 11 GLN A 17 ? ? -34.75 -32.98 132 11 ASP A 24 ? ? -34.76 141.85 133 11 CYS A 46 ? ? -59.51 -176.44 134 11 PRO A 48 ? ? -69.78 14.14 135 11 PRO A 62 ? ? -69.83 4.52 136 11 ARG A 67 ? ? -36.71 133.61 137 11 ARG A 70 ? ? -51.46 103.37 138 11 PRO A 75 ? ? -69.73 -178.53 139 11 ASP A 82 ? ? -127.05 -58.23 140 11 GLU A 84 ? ? -46.38 159.24 141 11 ASP A 85 ? ? -89.57 43.34 142 12 GLN A 17 ? ? -36.72 -30.04 143 12 ASP A 24 ? ? -41.52 163.50 144 12 PHE A 35 ? ? -66.15 87.99 145 12 CYS A 46 ? ? -55.46 -177.52 146 12 PRO A 48 ? ? -69.75 17.42 147 12 ARG A 55 ? ? -56.12 -74.75 148 12 PRO A 62 ? ? -69.72 2.18 149 12 SER A 74 ? ? -55.70 108.86 150 12 GLU A 78 ? ? 34.45 52.42 151 12 ILE A 86 ? ? -51.81 175.36 152 13 SER A 5 ? ? -44.42 157.86 153 13 PRO A 8 ? ? -69.74 -177.94 154 13 ASN A 13 ? ? -34.98 133.30 155 13 GLN A 17 ? ? -36.25 -29.95 156 13 ASP A 24 ? ? -41.08 163.30 157 13 PHE A 35 ? ? -67.34 86.05 158 13 CYS A 46 ? ? -56.92 -177.71 159 13 PRO A 48 ? ? -69.74 17.16 160 13 ARG A 55 ? ? -83.01 -75.74 161 13 PRO A 62 ? ? -69.85 3.79 162 13 SER A 74 ? ? -34.64 99.36 163 13 ASP A 80 ? ? -53.66 -175.55 164 13 GLU A 81 ? ? 43.74 27.01 165 13 GLU A 84 ? ? -119.39 77.87 166 14 LYS A 9 ? ? -39.32 152.79 167 14 LEU A 14 ? ? 71.97 40.03 168 14 GLN A 17 ? ? -37.42 -34.24 169 14 CYS A 19 ? ? -45.81 158.15 170 14 ASP A 24 ? ? -35.76 145.25 171 14 PHE A 35 ? ? -66.54 86.91 172 14 PHE A 43 ? ? -30.29 114.86 173 14 ALA A 45 ? ? -169.72 119.49 174 14 CYS A 46 ? ? -64.70 -176.40 175 14 PRO A 48 ? ? -69.78 15.27 176 14 PRO A 62 ? ? -69.79 3.93 177 14 PRO A 75 ? ? -69.75 -166.93 178 14 GLU A 81 ? ? 47.75 25.82 179 15 PRO A 8 ? ? -69.73 2.94 180 15 LYS A 9 ? ? -33.98 133.29 181 15 LEU A 14 ? ? -88.20 39.24 182 15 GLN A 17 ? ? -36.76 -29.56 183 15 CYS A 19 ? ? -48.53 153.37 184 15 ASP A 24 ? ? -34.89 145.59 185 15 PHE A 35 ? ? -63.87 91.43 186 15 CYS A 46 ? ? -55.55 -178.34 187 15 PRO A 48 ? ? -69.80 13.07 188 15 PRO A 62 ? ? -69.70 4.12 189 15 SER A 74 ? ? -36.73 102.07 190 15 PRO A 75 ? ? -69.76 -179.53 191 15 GLU A 78 ? ? -80.87 45.74 192 15 ASP A 87 ? ? -80.35 45.88 193 15 SER A 88 ? ? 36.92 42.21 194 15 SER A 92 ? ? -43.44 155.52 195 16 PRO A 8 ? ? -69.68 90.55 196 16 LEU A 14 ? ? -92.73 57.12 197 16 GLN A 17 ? ? -39.77 -31.14 198 16 ASP A 24 ? ? -34.19 149.68 199 16 ASP A 33 ? ? -47.75 163.99 200 16 CYS A 46 ? ? -56.60 -179.27 201 16 PRO A 48 ? ? -69.79 15.01 202 16 PRO A 62 ? ? -69.80 5.53 203 16 GLU A 78 ? ? -79.83 49.24 204 16 ASP A 85 ? ? -99.93 50.85 205 16 ASP A 87 ? ? -123.90 -58.68 206 16 PRO A 90 ? ? -69.79 -175.46 207 17 SER A 2 ? ? -171.44 137.91 208 17 SER A 6 ? ? -170.09 125.25 209 17 PRO A 10 ? ? -69.70 -179.95 210 17 LYS A 12 ? ? -33.12 139.04 211 17 ASN A 13 ? ? -33.35 117.21 212 17 LEU A 14 ? ? -84.81 39.92 213 17 GLN A 17 ? ? -37.67 -29.17 214 17 CYS A 19 ? ? -49.13 153.66 215 17 ASP A 24 ? ? -38.08 142.50 216 17 PHE A 35 ? ? -64.33 89.13 217 17 CYS A 46 ? ? -56.78 -176.74 218 17 PRO A 48 ? ? -69.76 14.82 219 17 ARG A 55 ? ? -79.25 -76.23 220 17 PRO A 62 ? ? -69.81 3.70 221 17 ARG A 67 ? ? -34.61 132.68 222 17 GLU A 78 ? ? -53.49 109.42 223 17 GLU A 81 ? ? -35.93 130.08 224 17 GLU A 84 ? ? -43.06 99.77 225 17 PRO A 90 ? ? -69.72 -174.21 226 18 SER A 6 ? ? -47.71 171.77 227 18 ASN A 13 ? ? -89.79 43.42 228 18 GLN A 17 ? ? -37.23 -28.52 229 18 ASP A 24 ? ? -41.56 163.82 230 18 PHE A 35 ? ? -69.74 94.72 231 18 CYS A 46 ? ? -56.59 -176.88 232 18 PRO A 48 ? ? -69.69 15.80 233 18 PRO A 62 ? ? -69.77 4.33 234 18 GLU A 78 ? ? -59.37 105.20 235 18 ASP A 80 ? ? -45.62 163.40 236 19 ASN A 13 ? ? -34.87 147.34 237 19 LEU A 14 ? ? -102.77 42.95 238 19 GLN A 17 ? ? -38.17 -28.37 239 19 CYS A 19 ? ? -47.56 152.63 240 19 ASP A 24 ? ? -34.69 148.12 241 19 CYS A 46 ? ? -61.89 -177.28 242 19 PRO A 48 ? ? -69.79 18.04 243 19 PRO A 62 ? ? -69.76 4.09 244 19 PRO A 75 ? ? -69.76 -164.44 245 19 GLU A 84 ? ? -82.34 42.78 246 19 ASP A 87 ? ? -45.60 157.88 247 20 PRO A 10 ? ? -69.80 96.88 248 20 ASN A 13 ? ? -50.37 -178.45 249 20 GLN A 17 ? ? -36.78 -35.16 250 20 CYS A 19 ? ? -47.58 150.39 251 20 ASP A 24 ? ? -36.66 154.43 252 20 ILE A 26 ? ? -56.25 99.87 253 20 CYS A 46 ? ? -54.54 -177.72 254 20 PRO A 48 ? ? -69.82 16.28 255 20 PRO A 62 ? ? -69.73 3.24 256 20 SER A 74 ? ? -43.77 105.24 257 20 GLU A 78 ? ? -81.01 41.27 258 20 PRO A 90 ? ? -69.80 90.80 259 20 SER A 91 ? ? -170.12 147.66 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1WEO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WEO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 0.1mM ZnCl2; 1mM d-DTT; 0.02% NaN3; 90%H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1WEO _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing Delaglio,F. 2 NMRView 5.0.4 'data analysis' Johnson,B.A. 3 KUJIRA 0.863 'data analysis' Cobayashi,N. 4 CYANA 2.0.17 'structure solution' Guentert,P. 5 CYANA 2.0.17 refinement Guentert,P. 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TYR N N N N 277 TYR CA C N S 278 TYR C C N N 279 TYR O O N N 280 TYR CB C N N 281 TYR CG C Y N 282 TYR CD1 C Y N 283 TYR CD2 C Y N 284 TYR CE1 C Y N 285 TYR CE2 C Y N 286 TYR CZ C Y N 287 TYR OH O N N 288 TYR OXT O N N 289 TYR H H N N 290 TYR H2 H N N 291 TYR HA H N N 292 TYR HB2 H N N 293 TYR HB3 H N N 294 TYR HD1 H N N 295 TYR HD2 H N N 296 TYR HE1 H N N 297 TYR HE2 H N N 298 TYR HH H N N 299 TYR HXT H N N 300 VAL N N N N 301 VAL CA C N S 302 VAL C C N N 303 VAL O O N N 304 VAL CB C N N 305 VAL CG1 C N N 306 VAL CG2 C N N 307 VAL OXT O N N 308 VAL H H N N 309 VAL H2 H N N 310 VAL HA H N N 311 VAL HB H N N 312 VAL HG11 H N N 313 VAL HG12 H N N 314 VAL HG13 H N N 315 VAL HG21 H N N 316 VAL HG22 H N N 317 VAL HG23 H N N 318 VAL HXT H N N 319 ZN ZN ZN N N 320 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TYR N CA sing N N 264 TYR N H sing N N 265 TYR N H2 sing N N 266 TYR CA C sing N N 267 TYR CA CB sing N N 268 TYR CA HA sing N N 269 TYR C O doub N N 270 TYR C OXT sing N N 271 TYR CB CG sing N N 272 TYR CB HB2 sing N N 273 TYR CB HB3 sing N N 274 TYR CG CD1 doub Y N 275 TYR CG CD2 sing Y N 276 TYR CD1 CE1 sing Y N 277 TYR CD1 HD1 sing N N 278 TYR CD2 CE2 doub Y N 279 TYR CD2 HD2 sing N N 280 TYR CE1 CZ doub Y N 281 TYR CE1 HE1 sing N N 282 TYR CE2 CZ sing Y N 283 TYR CE2 HE2 sing N N 284 TYR CZ OH sing N N 285 TYR OH HH sing N N 286 TYR OXT HXT sing N N 287 VAL N CA sing N N 288 VAL N H sing N N 289 VAL N H2 sing N N 290 VAL CA C sing N N 291 VAL CA CB sing N N 292 VAL CA HA sing N N 293 VAL C O doub N N 294 VAL C OXT sing N N 295 VAL CB CG1 sing N N 296 VAL CB CG2 sing N N 297 VAL CB HB sing N N 298 VAL CG1 HG11 sing N N 299 VAL CG1 HG12 sing N N 300 VAL CG1 HG13 sing N N 301 VAL CG2 HG21 sing N N 302 VAL CG2 HG22 sing N N 303 VAL CG2 HG23 sing N N 304 VAL OXT HXT sing N N 305 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1WEO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_