data_1WH2 # _entry.id 1WH2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WH2 pdb_00001wh2 10.2210/pdb1wh2/pdb RCSB RCSB023572 ? ? WWPDB D_1000023572 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id atr001006188.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WH2 _pdbx_database_status.recvd_initial_deposition_date 2004-05-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nameki, N.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nameki, N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein At5g08430' _entity.formula_weight 8627.687 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'GYF domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGVRVLSYDKEKLNWLYKDPQGLVQGPFSLTQLKAWSDAEYFTKQFRVWMTGESMESAVLLTDVLRLSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGVRVLSYDKEKLNWLYKDPQGLVQGPFSLTQLKAWSDAEYFTKQFRVWMTGESMESAVLLTDVLRLSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier atr001006188.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 ARG n 1 10 VAL n 1 11 LEU n 1 12 SER n 1 13 TYR n 1 14 ASP n 1 15 LYS n 1 16 GLU n 1 17 LYS n 1 18 LEU n 1 19 ASN n 1 20 TRP n 1 21 LEU n 1 22 TYR n 1 23 LYS n 1 24 ASP n 1 25 PRO n 1 26 GLN n 1 27 GLY n 1 28 LEU n 1 29 VAL n 1 30 GLN n 1 31 GLY n 1 32 PRO n 1 33 PHE n 1 34 SER n 1 35 LEU n 1 36 THR n 1 37 GLN n 1 38 LEU n 1 39 LYS n 1 40 ALA n 1 41 TRP n 1 42 SER n 1 43 ASP n 1 44 ALA n 1 45 GLU n 1 46 TYR n 1 47 PHE n 1 48 THR n 1 49 LYS n 1 50 GLN n 1 51 PHE n 1 52 ARG n 1 53 VAL n 1 54 TRP n 1 55 MET n 1 56 THR n 1 57 GLY n 1 58 GLU n 1 59 SER n 1 60 MET n 1 61 GLU n 1 62 SER n 1 63 ALA n 1 64 VAL n 1 65 LEU n 1 66 LEU n 1 67 THR n 1 68 ASP n 1 69 VAL n 1 70 LEU n 1 71 ARG n 1 72 LEU n 1 73 SER n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 SER n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA RAFL09-47-K03' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030107-37 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y5843_ARATH _struct_ref.pdbx_db_accession Q9FT92 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VRVLSYDKEKLNWLYKDPQGLVQGPFSLTQLKAWSDAEYFTKQFRVWMTGESMESAVLLTDVLRL _struct_ref.pdbx_align_begin 444 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WH2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9FT92 _struct_ref_seq.db_align_beg 444 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 508 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WH2 GLY A 1 ? UNP Q9FT92 ? ? 'cloning artifact' 1 1 1 1WH2 SER A 2 ? UNP Q9FT92 ? ? 'cloning artifact' 2 2 1 1WH2 SER A 3 ? UNP Q9FT92 ? ? 'cloning artifact' 3 3 1 1WH2 GLY A 4 ? UNP Q9FT92 ? ? 'cloning artifact' 4 4 1 1WH2 SER A 5 ? UNP Q9FT92 ? ? 'cloning artifact' 5 5 1 1WH2 SER A 6 ? UNP Q9FT92 ? ? 'cloning artifact' 6 6 1 1WH2 GLY A 7 ? UNP Q9FT92 ? ? 'cloning artifact' 7 7 1 1WH2 SER A 73 ? UNP Q9FT92 ? ? 'cloning artifact' 73 8 1 1WH2 GLY A 74 ? UNP Q9FT92 ? ? 'cloning artifact' 74 9 1 1WH2 PRO A 75 ? UNP Q9FT92 ? ? 'cloning artifact' 75 10 1 1WH2 SER A 76 ? UNP Q9FT92 ? ? 'cloning artifact' 76 11 1 1WH2 SER A 77 ? UNP Q9FT92 ? ? 'cloning artifact' 77 12 1 1WH2 GLY A 78 ? UNP Q9FT92 ? ? 'cloning artifact' 78 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.4mM GYF domain U-15N, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1WH2 _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WH2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WH2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.901 'data analysis' 'Kobayashi, N.' 4 CYANA 1.0.7 'structure solution' 'Guentert, P.' 5 OPALp ? refinement 'Koradi, R.,Billeter, M.,Guentert, P.' 6 # _exptl.entry_id 1WH2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WH2 _struct.title 'Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WH2 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'GYF domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 34 ? ASP A 43 ? SER A 34 ASP A 43 1 ? 10 HELX_P HELX_P2 2 LEU A 66 ? SER A 73 ? LEU A 66 SER A 73 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 1 9.01 2 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 2 1.02 3 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 3 9.07 4 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 4 18.58 5 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 5 8.63 6 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 6 -2.58 7 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 7 8.01 8 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 8 21.27 9 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 9 12.24 10 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 10 15.18 11 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 11 10.57 12 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 12 10.57 13 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 13 19.39 14 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 14 9.71 15 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 15 4.71 16 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 16 6.49 17 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 17 -3.86 18 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 18 11.61 19 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 19 7.53 20 GLY 31 A . ? GLY 31 A PRO 32 A ? PRO 32 A 20 20.20 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 29 ? PHE A 33 ? VAL A 29 PHE A 33 A 2 TRP A 20 ? LYS A 23 ? TRP A 20 LYS A 23 A 3 ARG A 52 ? MET A 55 ? ARG A 52 MET A 55 A 4 VAL A 64 ? LEU A 65 ? VAL A 64 LEU A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 30 ? O GLN A 30 N TYR A 22 ? N TYR A 22 A 2 3 N LEU A 21 ? N LEU A 21 O TRP A 54 ? O TRP A 54 A 3 4 N VAL A 53 ? N VAL A 53 O VAL A 64 ? O VAL A 64 # _database_PDB_matrix.entry_id 1WH2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WH2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-28 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HG A SER 76 ? ? O A GLY 78 ? ? 1.60 2 9 OE1 A GLU 58 ? ? HG A SER 62 ? ? 1.59 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 52 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 52 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 52 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.47 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.17 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? 105.17 111.26 2 1 VAL A 8 ? ? -61.20 94.23 3 1 THR A 56 ? ? -61.01 97.44 4 1 SER A 77 ? ? 56.11 84.97 5 2 VAL A 8 ? ? -66.46 90.93 6 2 PHE A 47 ? ? -126.55 -157.20 7 2 SER A 77 ? ? 72.23 146.32 8 3 SER A 2 ? ? 37.10 52.99 9 3 LEU A 11 ? ? -155.84 86.14 10 3 LEU A 18 ? ? -66.02 96.30 11 3 SER A 73 ? ? -93.33 47.37 12 4 SER A 6 ? ? -58.74 177.16 13 4 VAL A 8 ? ? 69.56 153.64 14 4 LEU A 11 ? ? -107.85 69.77 15 5 SER A 5 ? ? -140.98 -50.77 16 5 PRO A 25 ? ? -78.92 39.02 17 5 SER A 73 ? ? -67.22 98.82 18 6 SER A 5 ? ? -109.04 76.21 19 6 VAL A 8 ? ? -61.40 82.77 20 6 TYR A 46 ? ? -67.98 11.45 21 7 SER A 2 ? ? -62.59 90.69 22 7 VAL A 8 ? ? -51.12 107.82 23 7 SER A 77 ? ? 30.33 77.89 24 8 SER A 3 ? ? 58.47 -171.60 25 8 SER A 5 ? ? 58.37 177.02 26 8 SER A 6 ? ? 53.99 18.61 27 8 VAL A 8 ? ? 69.09 133.17 28 8 PRO A 25 ? ? -80.24 45.02 29 8 LEU A 72 ? ? -69.66 0.16 30 8 SER A 77 ? ? 52.27 -161.64 31 9 SER A 5 ? ? 33.21 71.31 32 9 SER A 6 ? ? -54.40 107.94 33 9 VAL A 8 ? ? -124.78 -155.90 34 9 GLU A 16 ? ? -100.10 -72.46 35 9 PHE A 47 ? ? -122.74 -161.92 36 9 GLN A 50 ? ? -144.08 48.74 37 10 SER A 2 ? ? -67.82 -173.80 38 10 SER A 3 ? ? -147.59 -158.14 39 10 SER A 5 ? ? 48.06 95.87 40 10 SER A 73 ? ? -80.65 48.17 41 11 SER A 3 ? ? -109.59 -162.78 42 11 SER A 5 ? ? -66.74 -161.34 43 11 VAL A 8 ? ? -97.74 56.66 44 11 PRO A 25 ? ? -86.24 40.38 45 11 GLN A 50 ? ? -142.06 28.44 46 11 THR A 56 ? ? -54.13 102.46 47 11 SER A 77 ? ? -165.07 -19.93 48 12 VAL A 10 ? ? 58.91 156.96 49 12 ALA A 44 ? ? -69.89 13.45 50 12 TYR A 46 ? ? -64.88 9.14 51 12 SER A 73 ? ? -93.44 44.14 52 13 ARG A 9 ? ? 44.33 -159.54 53 13 LEU A 11 ? ? -150.05 88.01 54 13 GLN A 50 ? ? -142.19 48.60 55 13 SER A 73 ? ? -110.72 62.98 56 14 SER A 2 ? ? 60.57 -89.25 57 14 VAL A 8 ? ? -125.88 -144.85 58 14 ASP A 14 ? ? -62.46 99.03 59 14 PHE A 47 ? ? -116.87 -158.79 60 14 LYS A 49 ? ? -68.62 2.32 61 15 SER A 3 ? ? 57.57 -169.98 62 15 GLN A 50 ? ? -143.52 40.10 63 16 SER A 5 ? ? 60.03 78.62 64 16 ASN A 19 ? ? -150.56 10.55 65 16 SER A 73 ? ? -96.55 44.80 66 16 PRO A 75 ? ? -73.32 -167.56 67 16 SER A 77 ? ? 70.43 158.11 68 17 TYR A 46 ? ? -66.05 9.09 69 18 ARG A 9 ? ? 56.48 172.02 70 18 PHE A 47 ? ? -115.53 -148.09 71 18 GLN A 50 ? ? -80.15 35.47 72 19 SER A 5 ? ? 39.26 -95.73 73 19 ARG A 9 ? ? 44.73 8.64 74 19 GLN A 30 ? ? -80.95 -158.95 75 19 SER A 76 ? ? 66.00 105.33 76 20 ARG A 9 ? ? 33.48 46.94 77 20 SER A 76 ? ? -57.88 104.82 78 20 SER A 77 ? ? 11.91 78.75 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 SER A 77 ? ? GLY A 78 ? ? 147.21 2 12 SER A 77 ? ? GLY A 78 ? ? -140.41 3 19 GLN A 30 ? ? GLY A 31 ? ? 146.49 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 52 ? ? 0.084 'SIDE CHAIN' 2 3 ARG A 52 ? ? 0.081 'SIDE CHAIN' 3 4 TYR A 22 ? ? 0.074 'SIDE CHAIN' 4 5 ARG A 9 ? ? 0.087 'SIDE CHAIN' 5 8 ARG A 71 ? ? 0.100 'SIDE CHAIN' #