data_1WHZ # _entry.id 1WHZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1WHZ RCSB RCSB023598 WWPDB D_1000023598 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003001707.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WHZ _pdbx_database_status.recvd_initial_deposition_date 2004-05-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kanagawa, M.' 1 'Yokoyama, S.' 2 'Kuramitsu, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Crystal structure of a hypothetical protein from thermus thermophilus HB8' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kanagawa, M.' 1 primary 'Yokoyama, S.' 2 primary 'Kuramitsu, S.' 3 # _cell.entry_id 1WHZ _cell.length_a 27.040 _cell.length_b 27.910 _cell.length_c 36.990 _cell.angle_alpha 90.00 _cell.angle_beta 90.31 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1WHZ _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein' 8322.239 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 120 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)W(MSE)PPRPEEVARKLRRLGFVER(MSE)AKGGHRLYTHPDGRIVVVPFHSGELPKGTFKRILRDAGLTEEEFH NL ; _entity_poly.pdbx_seq_one_letter_code_can MWMPPRPEEVARKLRRLGFVERMAKGGHRLYTHPDGRIVVVPFHSGELPKGTFKRILRDAGLTEEEFHNL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003001707.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 TRP n 1 3 MSE n 1 4 PRO n 1 5 PRO n 1 6 ARG n 1 7 PRO n 1 8 GLU n 1 9 GLU n 1 10 VAL n 1 11 ALA n 1 12 ARG n 1 13 LYS n 1 14 LEU n 1 15 ARG n 1 16 ARG n 1 17 LEU n 1 18 GLY n 1 19 PHE n 1 20 VAL n 1 21 GLU n 1 22 ARG n 1 23 MSE n 1 24 ALA n 1 25 LYS n 1 26 GLY n 1 27 GLY n 1 28 HIS n 1 29 ARG n 1 30 LEU n 1 31 TYR n 1 32 THR n 1 33 HIS n 1 34 PRO n 1 35 ASP n 1 36 GLY n 1 37 ARG n 1 38 ILE n 1 39 VAL n 1 40 VAL n 1 41 VAL n 1 42 PRO n 1 43 PHE n 1 44 HIS n 1 45 SER n 1 46 GLY n 1 47 GLU n 1 48 LEU n 1 49 PRO n 1 50 LYS n 1 51 GLY n 1 52 THR n 1 53 PHE n 1 54 LYS n 1 55 ARG n 1 56 ILE n 1 57 LEU n 1 58 ARG n 1 59 ASP n 1 60 ALA n 1 61 GLY n 1 62 LEU n 1 63 THR n 1 64 GLU n 1 65 GLU n 1 66 GLU n 1 67 PHE n 1 68 HIS n 1 69 ASN n 1 70 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SH17_THET8 _struct_ref.pdbx_db_accession Q5SH17 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WHZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SH17 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1WHZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.68 _exptl_crystal.density_percent_sol 26.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.2 _exptl_crystal_grow.pdbx_details 'PegMME, natrium chloride, Bicine, pH 9.2, VAPOR DIFFUSION, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2004-03-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si double crystal' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9000 1.0 2 0.979105 1.0 3 0.979416 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9000, 0.979105, 0.979416' # _reflns.entry_id 1WHZ _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 36.99 _reflns.d_resolution_high 1.52 _reflns.number_obs ? _reflns.number_all 8647 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 12.8 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.52 _reflns_shell.d_res_low 1.62 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1WHZ _refine.ls_number_reflns_obs 8647 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F .0 _refine.pdbx_data_cutoff_high_absF 482173.19 _refine.pdbx_data_cutoff_low_absF .000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 36.99 _refine.ls_d_res_high 1.52 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs 0.148 _refine.ls_R_factor_all 0.155 _refine.ls_R_factor_R_work 0.148 _refine.ls_R_factor_R_free 0.209 _refine.ls_R_factor_R_free_error .007 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.7 _refine.ls_number_reflns_R_free 922 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 13.8 _refine.aniso_B[1][1] .39 _refine.aniso_B[2][2] -1.48 _refine.aniso_B[3][3] 1.09 _refine.aniso_B[1][2] .00 _refine.aniso_B[1][3] -.23 _refine.aniso_B[2][3] .00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol .328647 _refine.solvent_model_param_bsol 50.6231 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1WHZ _refine_analyze.Luzzati_coordinate_error_obs .13 _refine_analyze.Luzzati_sigma_a_obs .07 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free .18 _refine_analyze.Luzzati_sigma_a_free .11 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 576 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 120 _refine_hist.number_atoms_total 697 _refine_hist.d_res_high 1.52 _refine_hist.d_res_low 36.99 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d .035 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 2.8 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.4 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 2.20 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.44 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.18 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.58 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.70 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.52 _refine_ls_shell.d_res_low 1.62 _refine_ls_shell.number_reflns_R_work 1280 _refine_ls_shell.R_factor_R_work 0.174 _refine_ls_shell.percent_reflns_obs 99.9 _refine_ls_shell.R_factor_R_free 0.23 _refine_ls_shell.R_factor_R_free_error .019 _refine_ls_shell.percent_reflns_R_free 10.3 _refine_ls_shell.number_reflns_R_free 147 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER_PROTIN.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1WHZ _struct.title 'Crystal structure of a hypothetical protein from thermus thermophilus HB8' _struct.pdbx_descriptor 'Hypothetical protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WHZ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'Alpha and beta protein, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 6 ? LEU A 17 ? ARG A 6 LEU A 17 1 ? 12 HELX_P HELX_P2 2 PRO A 49 ? ALA A 60 ? PRO A 49 ALA A 60 1 ? 12 HELX_P HELX_P3 3 THR A 63 ? LEU A 70 ? THR A 63 LEU A 70 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A TRP 2 N ? ? A MSE 1 A TRP 2 1_555 ? ? ? ? ? ? ? 1.362 ? covale2 covale ? ? A TRP 2 C ? ? ? 1_555 A MSE 3 N ? ? A TRP 2 A MSE 3 1_555 ? ? ? ? ? ? ? 1.339 ? covale3 covale ? ? A MSE 3 C ? ? ? 1_555 A PRO 4 N ? ? A MSE 3 A PRO 4 1_555 ? ? ? ? ? ? ? 1.306 ? covale4 covale ? ? A ARG 22 C ? ? ? 1_555 A MSE 23 N ? ? A ARG 22 A MSE 23 1_555 ? ? ? ? ? ? ? 1.336 ? covale5 covale ? ? A MSE 23 C ? ? ? 1_555 A ALA 24 N ? ? A MSE 23 A ALA 24 1_555 ? ? ? ? ? ? ? 1.303 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 20 ? LYS A 25 ? VAL A 20 LYS A 25 A 2 HIS A 28 ? THR A 32 ? HIS A 28 THR A 32 A 3 ILE A 38 ? PRO A 42 ? ILE A 38 PRO A 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 22 ? N ARG A 22 O LEU A 30 ? O LEU A 30 A 2 3 N TYR A 31 ? N TYR A 31 O VAL A 39 ? O VAL A 39 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE CL A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 16 ? ARG A 16 . ? 1_555 ? 2 AC1 3 ASN A 69 ? ASN A 69 . ? 1_555 ? 3 AC1 3 HOH C . ? HOH A 1115 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WHZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] .000000 _database_PDB_matrix.origx[1][3] .000000 _database_PDB_matrix.origx[2][1] .000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] .000000 _database_PDB_matrix.origx[3][1] .000000 _database_PDB_matrix.origx[3][2] .000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] .00000 _database_PDB_matrix.origx_vector[2] .00000 _database_PDB_matrix.origx_vector[3] .00000 # _atom_sites.entry_id 1WHZ _atom_sites.fract_transf_matrix[1][1] .036982 _atom_sites.fract_transf_matrix[1][2] .000000 _atom_sites.fract_transf_matrix[1][3] .000200 _atom_sites.fract_transf_matrix[2][1] .000000 _atom_sites.fract_transf_matrix[2][2] .035829 _atom_sites.fract_transf_matrix[2][3] .000000 _atom_sites.fract_transf_matrix[3][1] .000000 _atom_sites.fract_transf_matrix[3][2] .000000 _atom_sites.fract_transf_matrix[3][3] .027035 _atom_sites.fract_transf_vector[1] .00000 _atom_sites.fract_transf_vector[2] .00000 _atom_sites.fract_transf_vector[3] .00000 # loop_ _atom_type.symbol C CL N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 TRP 2 2 2 TRP TRP A . n A 1 3 MSE 3 3 3 MSE MSE A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 MSE 23 23 23 MSE MSE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 LEU 70 70 70 LEU LEU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 1001 1 CL CL A . C 3 HOH 1 1002 1 HOH TIP A . C 3 HOH 2 1003 2 HOH TIP A . C 3 HOH 3 1004 3 HOH TIP A . C 3 HOH 4 1005 4 HOH TIP A . C 3 HOH 5 1006 5 HOH TIP A . C 3 HOH 6 1007 6 HOH TIP A . C 3 HOH 7 1008 7 HOH TIP A . C 3 HOH 8 1009 8 HOH TIP A . C 3 HOH 9 1010 9 HOH TIP A . C 3 HOH 10 1011 10 HOH TIP A . C 3 HOH 11 1012 11 HOH TIP A . C 3 HOH 12 1013 12 HOH TIP A . C 3 HOH 13 1014 13 HOH TIP A . C 3 HOH 14 1015 14 HOH TIP A . C 3 HOH 15 1016 15 HOH TIP A . C 3 HOH 16 1017 16 HOH TIP A . C 3 HOH 17 1018 17 HOH TIP A . C 3 HOH 18 1019 18 HOH TIP A . C 3 HOH 19 1020 19 HOH TIP A . C 3 HOH 20 1021 20 HOH TIP A . C 3 HOH 21 1022 21 HOH TIP A . C 3 HOH 22 1023 22 HOH TIP A . C 3 HOH 23 1024 23 HOH TIP A . C 3 HOH 24 1025 24 HOH TIP A . C 3 HOH 25 1026 25 HOH TIP A . C 3 HOH 26 1027 26 HOH TIP A . C 3 HOH 27 1028 27 HOH TIP A . C 3 HOH 28 1029 28 HOH TIP A . C 3 HOH 29 1030 29 HOH TIP A . C 3 HOH 30 1031 30 HOH TIP A . C 3 HOH 31 1032 31 HOH TIP A . C 3 HOH 32 1033 32 HOH TIP A . C 3 HOH 33 1034 33 HOH TIP A . C 3 HOH 34 1035 34 HOH TIP A . C 3 HOH 35 1036 35 HOH TIP A . C 3 HOH 36 1037 36 HOH TIP A . C 3 HOH 37 1038 37 HOH TIP A . C 3 HOH 38 1039 38 HOH TIP A . C 3 HOH 39 1040 39 HOH TIP A . C 3 HOH 40 1041 40 HOH TIP A . C 3 HOH 41 1042 41 HOH TIP A . C 3 HOH 42 1043 42 HOH TIP A . C 3 HOH 43 1044 43 HOH TIP A . C 3 HOH 44 1045 44 HOH TIP A . C 3 HOH 45 1046 45 HOH TIP A . C 3 HOH 46 1047 46 HOH TIP A . C 3 HOH 47 1048 48 HOH TIP A . C 3 HOH 48 1049 49 HOH TIP A . C 3 HOH 49 1050 50 HOH TIP A . C 3 HOH 50 1051 51 HOH TIP A . C 3 HOH 51 1052 52 HOH TIP A . C 3 HOH 52 1053 53 HOH TIP A . C 3 HOH 53 1054 54 HOH TIP A . C 3 HOH 54 1055 55 HOH TIP A . C 3 HOH 55 1056 56 HOH TIP A . C 3 HOH 56 1057 57 HOH TIP A . C 3 HOH 57 1058 58 HOH TIP A . C 3 HOH 58 1059 59 HOH TIP A . C 3 HOH 59 1060 60 HOH TIP A . C 3 HOH 60 1061 61 HOH TIP A . C 3 HOH 61 1062 62 HOH TIP A . C 3 HOH 62 1063 63 HOH TIP A . C 3 HOH 63 1064 64 HOH TIP A . C 3 HOH 64 1065 65 HOH TIP A . C 3 HOH 65 1066 66 HOH TIP A . C 3 HOH 66 1067 67 HOH TIP A . C 3 HOH 67 1068 68 HOH TIP A . C 3 HOH 68 1069 69 HOH TIP A . C 3 HOH 69 1070 70 HOH TIP A . C 3 HOH 70 1071 71 HOH TIP A . C 3 HOH 71 1072 72 HOH TIP A . C 3 HOH 72 1073 73 HOH TIP A . C 3 HOH 73 1074 74 HOH TIP A . C 3 HOH 74 1075 75 HOH TIP A . C 3 HOH 75 1076 76 HOH TIP A . C 3 HOH 76 1077 77 HOH TIP A . C 3 HOH 77 1078 78 HOH TIP A . C 3 HOH 78 1079 79 HOH TIP A . C 3 HOH 79 1080 80 HOH TIP A . C 3 HOH 80 1081 81 HOH TIP A . C 3 HOH 81 1082 82 HOH TIP A . C 3 HOH 82 1083 83 HOH TIP A . C 3 HOH 83 1084 84 HOH TIP A . C 3 HOH 84 1085 85 HOH TIP A . C 3 HOH 85 1086 86 HOH TIP A . C 3 HOH 86 1087 88 HOH TIP A . C 3 HOH 87 1088 89 HOH TIP A . C 3 HOH 88 1089 90 HOH TIP A . C 3 HOH 89 1090 91 HOH TIP A . C 3 HOH 90 1091 92 HOH TIP A . C 3 HOH 91 1092 93 HOH TIP A . C 3 HOH 92 1093 94 HOH TIP A . C 3 HOH 93 1094 95 HOH TIP A . C 3 HOH 94 1095 96 HOH TIP A . C 3 HOH 95 1096 97 HOH TIP A . C 3 HOH 96 1097 98 HOH TIP A . C 3 HOH 97 1098 99 HOH TIP A . C 3 HOH 98 1099 100 HOH TIP A . C 3 HOH 99 1100 101 HOH TIP A . C 3 HOH 100 1101 102 HOH TIP A . C 3 HOH 101 1102 103 HOH TIP A . C 3 HOH 102 1103 104 HOH TIP A . C 3 HOH 103 1104 105 HOH TIP A . C 3 HOH 104 1105 106 HOH TIP A . C 3 HOH 105 1106 107 HOH TIP A . C 3 HOH 106 1107 108 HOH TIP A . C 3 HOH 107 1108 109 HOH TIP A . C 3 HOH 108 1109 110 HOH TIP A . C 3 HOH 109 1110 111 HOH TIP A . C 3 HOH 110 1111 112 HOH TIP A . C 3 HOH 111 1112 113 HOH TIP A . C 3 HOH 112 1113 114 HOH TIP A . C 3 HOH 113 1114 115 HOH TIP A . C 3 HOH 114 1115 116 HOH TIP A . C 3 HOH 115 1116 117 HOH TIP A . C 3 HOH 116 1117 118 HOH TIP A . C 3 HOH 117 1118 119 HOH TIP A . C 3 HOH 118 1119 120 HOH TIP A . C 3 HOH 119 1120 121 HOH TIP A . C 3 HOH 120 1121 122 HOH TIP A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 3 A MSE 3 ? MET SELENOMETHIONINE 3 A MSE 23 A MSE 23 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-28 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2016-09-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Other # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 CrystalClear 'data reduction' '(MSC/RIGAKU)' ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 1098 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 1119 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 1024 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 1117 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_646 _pdbx_validate_symm_contact.dist 2.19 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CZ _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ARG _pdbx_validate_rmsd_bond.auth_seq_id_1 58 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 NH2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ARG _pdbx_validate_rmsd_bond.auth_seq_id_2 58 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.413 _pdbx_validate_rmsd_bond.bond_target_value 1.326 _pdbx_validate_rmsd_bond.bond_deviation 0.087 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.013 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A ARG 6 ? ? CD A ARG 6 ? ? NE A ARG 6 ? ? 124.43 111.80 12.63 2.10 N 2 1 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.66 120.30 3.36 0.50 N 3 1 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH2 A ARG 6 ? ? 114.82 120.30 -5.48 0.50 N 4 1 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 125.88 120.30 5.58 0.50 N 5 1 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH2 A ARG 29 ? ? 115.71 120.30 -4.59 0.50 N 6 1 CB A ASP 35 ? ? CG A ASP 35 ? ? OD1 A ASP 35 ? ? 124.62 118.30 6.32 0.90 N 7 1 NE A ARG 37 ? ? CZ A ARG 37 ? ? NH1 A ARG 37 ? ? 125.42 120.30 5.12 0.50 N 8 1 NE A ARG 58 ? ? CZ A ARG 58 ? ? NH2 A ARG 58 ? ? 124.16 120.30 3.86 0.50 N # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH #