data_1WJ0 # _entry.id 1WJ0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WJ0 pdb_00001wj0 10.2210/pdb1wj0/pdb RCSB RCSB023630 ? ? WWPDB D_1000023630 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-28 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.value' 9 4 'Structure model' '_struct_conn.pdbx_dist_value' 10 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 4 'Structure model' '_struct_ref_seq_dif.details' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WJ0 _pdbx_database_status.recvd_initial_deposition_date 2004-05-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id atr001004282.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yamasaki, K.' 1 'Inoue, M.' 2 'Kigawa, T.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Structure of the SBP Domain That Lacks the Second Zinc-Binding Site' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yamasaki, K.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Inoue, M.' 3 ? primary 'Yamasaki, T.' 4 ? primary 'Yabuki, T.' 5 ? primary 'Aoki, M.' 6 ? primary 'Seki, E.' 7 ? primary 'Matsuda, T.' 8 ? primary 'Tomo, Y.' 9 ? primary 'Terada, T.' 10 ? primary 'Shirouzu, M.' 11 ? primary 'Tanaka, A.' 12 ? primary 'Seki, M.' 13 ? primary 'Shinozaki, K.' 14 ? primary 'Yokoyama, S.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'squamosa promoter-binding protein-like 12' 6782.792 1 ? ? 'DNA-binding domain (short fragment)' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SPL12, Transcription Factor SPL12' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSAICCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFD _entity_poly.pdbx_seq_one_letter_code_can GSAICCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier atr001004282.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 ILE n 1 5 CYS n 1 6 CYS n 1 7 GLN n 1 8 VAL n 1 9 ASP n 1 10 ASN n 1 11 CYS n 1 12 GLY n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 SER n 1 17 LYS n 1 18 VAL n 1 19 LYS n 1 20 ASP n 1 21 TYR n 1 22 HIS n 1 23 ARG n 1 24 ARG n 1 25 HIS n 1 26 LYS n 1 27 VAL n 1 28 CYS n 1 29 GLU n 1 30 ILE n 1 31 HIS n 1 32 SER n 1 33 LYS n 1 34 ALA n 1 35 THR n 1 36 THR n 1 37 ALA n 1 38 LEU n 1 39 VAL n 1 40 GLY n 1 41 GLY n 1 42 ILE n 1 43 MET n 1 44 GLN n 1 45 ARG n 1 46 PHE n 1 47 CYS n 1 48 GLN n 1 49 GLN n 1 50 CYS n 1 51 SER n 1 52 ARG n 1 53 PHE n 1 54 HIS n 1 55 VAL n 1 56 LEU n 1 57 GLU n 1 58 GLU n 1 59 PHE n 1 60 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene SPL12 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pCR2.1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 122 ? ? ? A . n A 1 2 SER 2 123 ? ? ? A . n A 1 3 ALA 3 124 124 ALA ALA A . n A 1 4 ILE 4 125 125 ILE ILE A . n A 1 5 CYS 5 126 126 CYS CYS A . n A 1 6 CYS 6 127 127 CYS CYS A . n A 1 7 GLN 7 128 128 GLN GLN A . n A 1 8 VAL 8 129 129 VAL VAL A . n A 1 9 ASP 9 130 130 ASP ASP A . n A 1 10 ASN 10 131 131 ASN ASN A . n A 1 11 CYS 11 132 132 CYS CYS A . n A 1 12 GLY 12 133 133 GLY GLY A . n A 1 13 ALA 13 134 134 ALA ALA A . n A 1 14 ASP 14 135 135 ASP ASP A . n A 1 15 LEU 15 136 136 LEU LEU A . n A 1 16 SER 16 137 137 SER SER A . n A 1 17 LYS 17 138 138 LYS LYS A . n A 1 18 VAL 18 139 139 VAL VAL A . n A 1 19 LYS 19 140 140 LYS LYS A . n A 1 20 ASP 20 141 141 ASP ASP A . n A 1 21 TYR 21 142 142 TYR TYR A . n A 1 22 HIS 22 143 143 HIS HIS A . n A 1 23 ARG 23 144 144 ARG ARG A . n A 1 24 ARG 24 145 145 ARG ARG A . n A 1 25 HIS 25 146 146 HIS HIS A . n A 1 26 LYS 26 147 147 LYS LYS A . n A 1 27 VAL 27 148 148 VAL VAL A . n A 1 28 CYS 28 149 149 CYS CYS A . n A 1 29 GLU 29 150 150 GLU GLU A . n A 1 30 ILE 30 151 151 ILE ILE A . n A 1 31 HIS 31 152 152 HIS HIS A . n A 1 32 SER 32 153 153 SER SER A . n A 1 33 LYS 33 154 154 LYS LYS A . n A 1 34 ALA 34 155 155 ALA ALA A . n A 1 35 THR 35 156 156 THR THR A . n A 1 36 THR 36 157 157 THR THR A . n A 1 37 ALA 37 158 158 ALA ALA A . n A 1 38 LEU 38 159 159 LEU LEU A . n A 1 39 VAL 39 160 160 VAL VAL A . n A 1 40 GLY 40 161 161 GLY GLY A . n A 1 41 GLY 41 162 162 GLY GLY A . n A 1 42 ILE 42 163 163 ILE ILE A . n A 1 43 MET 43 164 164 MET MET A . n A 1 44 GLN 44 165 165 GLN GLN A . n A 1 45 ARG 45 166 166 ARG ARG A . n A 1 46 PHE 46 167 167 PHE PHE A . n A 1 47 CYS 47 168 168 CYS CYS A . n A 1 48 GLN 48 169 169 GLN GLN A . n A 1 49 GLN 49 170 170 GLN GLN A . n A 1 50 CYS 50 171 171 CYS CYS A . n A 1 51 SER 51 172 172 SER SER A . n A 1 52 ARG 52 173 173 ARG ARG A . n A 1 53 PHE 53 174 174 PHE PHE A . n A 1 54 HIS 54 175 175 HIS HIS A . n A 1 55 VAL 55 176 176 VAL VAL A . n A 1 56 LEU 56 177 177 LEU LEU A . n A 1 57 GLU 57 178 178 GLU GLU A . n A 1 58 GLU 58 179 179 GLU GLU A . n A 1 59 PHE 59 180 180 PHE PHE A . n A 1 60 ASP 60 181 181 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 182 _pdbx_nonpoly_scheme.auth_seq_num 182 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1WJ0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WJ0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WJ0 _struct.title 'Solution Structure of the DNA-Binding Domain of Squamosa Promoter Binding Protein-Like 12 Lacking the Second Zinc-Binding Site' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WJ0 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-binding domain, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPL12_ARATH _struct_ref.pdbx_db_accession Q9S7P5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AICCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFD _struct_ref.pdbx_align_begin 124 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WJ0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9S7P5 _struct_ref_seq.db_align_beg 124 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 124 _struct_ref_seq.pdbx_auth_seq_align_end 181 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WJ0 GLY A 1 ? UNP Q9S7P5 ? ? 'cloning artifact' 122 1 1 1WJ0 SER A 2 ? UNP Q9S7P5 ? ? 'cloning artifact' 123 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 28 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 149 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 154 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 127 A ZN 182 1_555 ? ? ? ? ? ? ? 2.469 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 132 A ZN 182 1_555 ? ? ? ? ? ? ? 2.465 ? ? metalc3 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 149 A ZN 182 1_555 ? ? ? ? ? ? ? 2.474 ? ? metalc4 metalc ? ? A HIS 31 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 152 A ZN 182 1_555 ? ? ? ? ? ? ? 2.143 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 127 ? 1_555 ZN ? B ZN . ? A ZN 182 ? 1_555 SG ? A CYS 11 ? A CYS 132 ? 1_555 107.2 ? 2 SG ? A CYS 6 ? A CYS 127 ? 1_555 ZN ? B ZN . ? A ZN 182 ? 1_555 SG ? A CYS 28 ? A CYS 149 ? 1_555 111.3 ? 3 SG ? A CYS 11 ? A CYS 132 ? 1_555 ZN ? B ZN . ? A ZN 182 ? 1_555 SG ? A CYS 28 ? A CYS 149 ? 1_555 111.4 ? 4 SG ? A CYS 6 ? A CYS 127 ? 1_555 ZN ? B ZN . ? A ZN 182 ? 1_555 ND1 ? A HIS 31 ? A HIS 152 ? 1_555 112.2 ? 5 SG ? A CYS 11 ? A CYS 132 ? 1_555 ZN ? B ZN . ? A ZN 182 ? 1_555 ND1 ? A HIS 31 ? A HIS 152 ? 1_555 108.4 ? 6 SG ? A CYS 28 ? A CYS 149 ? 1_555 ZN ? B ZN . ? A ZN 182 ? 1_555 ND1 ? A HIS 31 ? A HIS 152 ? 1_555 106.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 4 ? CYS A 5 ? ILE A 125 CYS A 126 A 2 ASP A 14 ? LEU A 15 ? ASP A 135 LEU A 136 B 1 ALA A 37 ? VAL A 39 ? ALA A 158 VAL A 160 B 2 ILE A 42 ? GLN A 44 ? ILE A 163 GLN A 165 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 4 ? N ILE A 125 O LEU A 15 ? O LEU A 136 B 1 2 N ALA A 37 ? N ALA A 158 O GLN A 44 ? O GLN A 165 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 182 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 182' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 6 ? CYS A 127 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 132 . ? 1_555 ? 3 AC1 4 CYS A 28 ? CYS A 149 . ? 1_555 ? 4 AC1 4 HIS A 31 ? HIS A 152 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 141 ? ? -175.90 -174.84 2 1 TYR A 142 ? ? 68.55 -67.51 3 1 LYS A 147 ? ? 50.20 86.99 4 1 VAL A 148 ? ? -178.63 136.65 5 1 ILE A 151 ? ? -62.29 -70.01 6 1 SER A 172 ? ? 62.08 69.58 7 1 ARG A 173 ? ? -175.06 149.20 8 1 LEU A 177 ? ? -95.98 38.61 9 2 CYS A 132 ? ? -159.78 -66.89 10 2 LYS A 138 ? ? -96.39 38.31 11 2 LYS A 140 ? ? -98.12 -79.73 12 2 TYR A 142 ? ? 69.41 -65.44 13 2 ARG A 144 ? ? -152.19 -61.79 14 2 LYS A 147 ? ? 64.85 81.39 15 2 VAL A 148 ? ? -178.91 133.24 16 2 ILE A 151 ? ? -104.41 -68.45 17 2 VAL A 176 ? ? -51.79 179.38 18 2 LEU A 177 ? ? -96.77 30.60 19 3 LYS A 140 ? ? -75.44 -78.18 20 3 ASP A 141 ? ? -167.63 -42.10 21 3 HIS A 143 ? ? -99.75 34.45 22 3 ARG A 144 ? ? -124.58 -63.18 23 3 LYS A 147 ? ? 61.49 64.41 24 3 CYS A 149 ? ? -67.56 -167.53 25 4 LEU A 136 ? ? -91.49 50.47 26 4 VAL A 139 ? ? -57.31 173.13 27 4 LYS A 140 ? ? -71.27 -74.07 28 4 ASP A 141 ? ? -169.71 -41.91 29 4 HIS A 143 ? ? -98.82 37.62 30 4 ARG A 144 ? ? -130.40 -64.86 31 4 LYS A 154 ? ? -148.49 30.16 32 4 VAL A 176 ? ? -49.17 174.38 33 4 LEU A 177 ? ? -95.35 40.56 34 5 LEU A 136 ? ? -107.72 45.11 35 5 LYS A 138 ? ? -107.22 41.36 36 5 LYS A 140 ? ? -68.16 -82.71 37 5 ASP A 141 ? ? 178.39 -43.85 38 5 SER A 172 ? ? 59.92 70.03 39 5 ARG A 173 ? ? -176.54 133.60 40 5 VAL A 176 ? ? -53.86 178.76 41 5 GLU A 178 ? ? -99.83 31.57 42 5 GLU A 179 ? ? -164.86 -43.09 43 5 PHE A 180 ? ? -59.21 105.20 44 6 GLN A 128 ? ? -94.64 40.94 45 6 LYS A 138 ? ? -96.69 32.00 46 6 ASP A 141 ? ? -174.44 -177.77 47 6 HIS A 143 ? ? -161.80 -45.41 48 6 LYS A 147 ? ? 66.24 75.66 49 6 VAL A 148 ? ? -179.40 134.76 50 6 HIS A 152 ? ? -96.40 33.72 51 6 VAL A 176 ? ? -48.42 171.38 52 7 LEU A 136 ? ? -95.49 41.03 53 7 LYS A 138 ? ? -97.58 30.98 54 7 LYS A 140 ? ? -106.08 -78.23 55 7 HIS A 143 ? ? -162.97 -45.10 56 7 LYS A 147 ? ? 62.62 75.57 57 7 VAL A 148 ? ? 179.73 139.35 58 7 ALA A 158 ? ? -175.33 130.86 59 7 LEU A 177 ? ? -91.44 51.06 60 8 LEU A 136 ? ? -94.55 45.07 61 8 LYS A 138 ? ? -98.27 30.68 62 8 LYS A 140 ? ? -83.46 -77.30 63 8 ASP A 141 ? ? -168.64 -42.09 64 8 ARG A 144 ? ? -126.18 -59.68 65 8 CYS A 149 ? ? -72.71 -168.58 66 8 ILE A 151 ? ? -59.73 -72.94 67 9 LEU A 136 ? ? -95.50 42.99 68 9 ASP A 141 ? ? -177.53 -38.10 69 9 ARG A 144 ? ? -96.82 33.30 70 9 LYS A 147 ? ? 52.53 79.52 71 9 LYS A 154 ? ? -143.93 31.66 72 9 ALA A 158 ? ? -169.93 107.68 73 9 VAL A 176 ? ? -53.88 178.81 74 9 LEU A 177 ? ? -98.24 31.09 75 10 CYS A 132 ? ? -131.38 -68.98 76 10 VAL A 139 ? ? -52.88 173.60 77 10 ASP A 141 ? ? -174.81 -40.62 78 10 HIS A 143 ? ? -166.15 -46.37 79 11 CYS A 132 ? ? -158.63 -66.68 80 11 LEU A 136 ? ? -96.56 40.49 81 11 LYS A 140 ? ? -120.53 -78.34 82 11 TYR A 142 ? ? 69.09 -66.64 83 11 ARG A 144 ? ? -97.44 37.42 84 11 LYS A 147 ? ? 57.63 93.92 85 11 VAL A 148 ? ? 179.29 146.30 86 11 GLU A 178 ? ? -138.16 -70.16 87 11 PHE A 180 ? ? -97.87 34.35 88 12 CYS A 132 ? ? -167.56 111.99 89 12 LEU A 136 ? ? -97.55 38.33 90 12 VAL A 139 ? ? -59.15 176.39 91 12 LYS A 140 ? ? -105.68 -78.75 92 12 TYR A 142 ? ? 69.02 -66.51 93 12 ARG A 144 ? ? -156.53 -64.60 94 12 LYS A 147 ? ? 67.46 79.78 95 12 VAL A 148 ? ? 179.07 149.72 96 12 LYS A 154 ? ? -147.40 34.52 97 12 SER A 172 ? ? 64.17 170.93 98 12 ARG A 173 ? ? 62.09 159.63 99 12 GLU A 179 ? ? -144.67 25.61 100 13 CYS A 132 ? ? -153.49 -67.03 101 13 VAL A 139 ? ? -59.66 -179.56 102 13 LYS A 140 ? ? -128.28 -78.16 103 13 HIS A 143 ? ? -165.91 -48.10 104 13 LYS A 147 ? ? 61.99 78.87 105 13 VAL A 148 ? ? -178.90 141.24 106 13 CYS A 149 ? ? -74.46 -166.07 107 13 ILE A 151 ? ? -60.05 -72.17 108 13 LYS A 154 ? ? -147.72 30.90 109 13 ALA A 158 ? ? -101.97 -169.72 110 13 GLN A 165 ? ? -170.38 -177.81 111 13 SER A 172 ? ? 63.74 159.18 112 13 ARG A 173 ? ? 61.33 160.55 113 13 LEU A 177 ? ? -63.09 88.12 114 13 GLU A 179 ? ? -157.06 31.34 115 14 ASP A 130 ? ? -55.21 -77.47 116 14 CYS A 132 ? ? -172.49 100.47 117 14 LYS A 140 ? ? -78.75 -78.31 118 14 ASP A 141 ? ? -168.04 -42.05 119 14 HIS A 143 ? ? -174.37 -41.80 120 14 ILE A 151 ? ? -59.65 -72.20 121 14 GLN A 170 ? ? -59.65 -75.47 122 14 PHE A 174 ? ? -68.90 96.89 123 14 VAL A 176 ? ? -51.74 176.38 124 14 LEU A 177 ? ? -97.96 31.29 125 14 GLU A 179 ? ? -164.79 -44.74 126 15 LEU A 136 ? ? -96.39 41.78 127 15 VAL A 139 ? ? -58.96 173.15 128 15 LYS A 140 ? ? -111.59 -77.19 129 15 TYR A 142 ? ? 69.33 -66.00 130 15 ARG A 144 ? ? -150.54 -56.98 131 15 LYS A 147 ? ? 64.60 80.49 132 15 VAL A 148 ? ? -179.57 124.59 133 15 CYS A 149 ? ? -58.41 -166.43 134 15 ILE A 151 ? ? -61.58 -70.32 135 15 SER A 172 ? ? 60.85 165.95 136 15 ARG A 173 ? ? 62.18 150.85 137 15 VAL A 176 ? ? -52.66 -178.77 138 15 LEU A 177 ? ? -91.09 38.93 139 15 GLU A 179 ? ? -98.09 31.27 140 16 CYS A 132 ? ? -155.84 -66.87 141 16 LYS A 138 ? ? -98.00 34.78 142 16 LYS A 140 ? ? -95.09 -69.49 143 16 ASP A 141 ? ? -174.18 -38.69 144 16 LYS A 147 ? ? 65.71 71.28 145 16 VAL A 148 ? ? 179.17 155.26 146 16 GLN A 169 ? ? 65.35 -75.85 147 16 SER A 172 ? ? 65.64 165.54 148 16 ARG A 173 ? ? 63.27 144.40 149 16 GLU A 178 ? ? -147.89 -49.09 150 17 GLN A 128 ? ? -96.60 34.24 151 17 LEU A 136 ? ? -92.69 47.90 152 17 LYS A 138 ? ? -95.46 35.06 153 17 ASP A 141 ? ? -177.54 -178.08 154 17 HIS A 143 ? ? -161.86 -49.24 155 17 LYS A 147 ? ? 65.68 78.37 156 17 VAL A 148 ? ? -174.80 135.65 157 17 CYS A 149 ? ? -73.91 -169.51 158 17 SER A 172 ? ? 65.87 163.30 159 17 ARG A 173 ? ? 62.00 166.01 160 17 GLU A 178 ? ? -172.60 78.61 161 18 ASP A 130 ? ? -56.33 -76.92 162 18 ASN A 131 ? ? -69.41 67.02 163 18 CYS A 132 ? ? -171.13 103.98 164 18 LYS A 140 ? ? -101.46 -76.95 165 18 TYR A 142 ? ? 69.08 -66.89 166 18 ILE A 151 ? ? -64.12 -70.35 167 18 VAL A 176 ? ? -50.76 178.37 168 18 LEU A 177 ? ? -93.62 44.23 169 19 ASP A 130 ? ? -54.85 -75.12 170 19 ASN A 131 ? ? -69.79 65.96 171 19 LYS A 140 ? ? -115.17 -77.83 172 19 HIS A 143 ? ? -164.17 -44.55 173 19 LYS A 147 ? ? 62.92 80.72 174 19 VAL A 148 ? ? -179.84 130.28 175 19 CYS A 149 ? ? -67.82 -172.13 176 19 ILE A 151 ? ? -104.11 -67.08 177 19 HIS A 175 ? ? -164.03 41.01 178 19 VAL A 176 ? ? 61.00 155.12 179 19 GLU A 178 ? ? -96.27 40.07 180 19 GLU A 179 ? ? 58.51 70.57 181 20 LEU A 136 ? ? -99.53 58.28 182 20 VAL A 139 ? ? -56.39 179.56 183 20 LYS A 140 ? ? -96.12 -75.80 184 20 ASP A 141 ? ? -157.95 -43.62 185 20 HIS A 143 ? ? -106.09 40.23 186 20 ARG A 144 ? ? -142.87 -48.86 187 20 THR A 157 ? ? -179.06 135.49 188 20 SER A 172 ? ? 61.10 167.31 189 20 ARG A 173 ? ? 60.73 158.01 190 20 VAL A 176 ? ? -49.59 164.71 191 20 LEU A 177 ? ? -96.77 37.62 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1WJ0 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WJ0 _pdbx_nmr_representative.conformer_id 9 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM SPL12-DBD fragment; 20mM KPi; 300mM KCl; 0.02mM ZNCL2; 1mM DTT; 95% H2O; 5% D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.3M _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY # _pdbx_nmr_refine.entry_id 1WJ0 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal Felix 2000 'data analysis' MSI 1 CNS 1.1 'structure solution' ? 2 CNS 1.1 refinement ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 122 ? A GLY 1 2 1 Y 1 A SER 123 ? A SER 2 3 2 Y 1 A GLY 122 ? A GLY 1 4 2 Y 1 A SER 123 ? A SER 2 5 3 Y 1 A GLY 122 ? A GLY 1 6 3 Y 1 A SER 123 ? A SER 2 7 4 Y 1 A GLY 122 ? A GLY 1 8 4 Y 1 A SER 123 ? A SER 2 9 5 Y 1 A GLY 122 ? A GLY 1 10 5 Y 1 A SER 123 ? A SER 2 11 6 Y 1 A GLY 122 ? A GLY 1 12 6 Y 1 A SER 123 ? A SER 2 13 7 Y 1 A GLY 122 ? A GLY 1 14 7 Y 1 A SER 123 ? A SER 2 15 8 Y 1 A GLY 122 ? A GLY 1 16 8 Y 1 A SER 123 ? A SER 2 17 9 Y 1 A GLY 122 ? A GLY 1 18 9 Y 1 A SER 123 ? A SER 2 19 10 Y 1 A GLY 122 ? A GLY 1 20 10 Y 1 A SER 123 ? A SER 2 21 11 Y 1 A GLY 122 ? A GLY 1 22 11 Y 1 A SER 123 ? A SER 2 23 12 Y 1 A GLY 122 ? A GLY 1 24 12 Y 1 A SER 123 ? A SER 2 25 13 Y 1 A GLY 122 ? A GLY 1 26 13 Y 1 A SER 123 ? A SER 2 27 14 Y 1 A GLY 122 ? A GLY 1 28 14 Y 1 A SER 123 ? A SER 2 29 15 Y 1 A GLY 122 ? A GLY 1 30 15 Y 1 A SER 123 ? A SER 2 31 16 Y 1 A GLY 122 ? A GLY 1 32 16 Y 1 A SER 123 ? A SER 2 33 17 Y 1 A GLY 122 ? A GLY 1 34 17 Y 1 A SER 123 ? A SER 2 35 18 Y 1 A GLY 122 ? A GLY 1 36 18 Y 1 A SER 123 ? A SER 2 37 19 Y 1 A GLY 122 ? A GLY 1 38 19 Y 1 A SER 123 ? A SER 2 39 20 Y 1 A GLY 122 ? A GLY 1 40 20 Y 1 A SER 123 ? A SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 ZN ZN ZN N N 344 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TYR N CA sing N N 287 TYR N H sing N N 288 TYR N H2 sing N N 289 TYR CA C sing N N 290 TYR CA CB sing N N 291 TYR CA HA sing N N 292 TYR C O doub N N 293 TYR C OXT sing N N 294 TYR CB CG sing N N 295 TYR CB HB2 sing N N 296 TYR CB HB3 sing N N 297 TYR CG CD1 doub Y N 298 TYR CG CD2 sing Y N 299 TYR CD1 CE1 sing Y N 300 TYR CD1 HD1 sing N N 301 TYR CD2 CE2 doub Y N 302 TYR CD2 HD2 sing N N 303 TYR CE1 CZ doub Y N 304 TYR CE1 HE1 sing N N 305 TYR CE2 CZ sing Y N 306 TYR CE2 HE2 sing N N 307 TYR CZ OH sing N N 308 TYR OH HH sing N N 309 TYR OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 750 # _atom_sites.entry_id 1WJ0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_