data_1WJB # _entry.id 1WJB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WJB pdb_00001wjb 10.2210/pdb1wjb/pdb WWPDB D_1000177207 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1WJA _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WJB _pdbx_database_status.recvd_initial_deposition_date 1997-05-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Cai, M.' 2 'Caffrey, M.' 3 'Gronenborn, A.M.' 4 # _citation.id primary _citation.title 'Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 4 _citation.page_first 567 _citation.page_last 577 _citation.year 1997 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9228950 _citation.pdbx_database_id_DOI 10.1038/nsb0797-567 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cai, M.' 1 ? primary 'Zheng, R.' 2 ? primary 'Caffrey, M.' 3 ? primary 'Craigie, R.' 4 ? primary 'Clore, G.M.' 5 ? primary 'Gronenborn, A.M.' 6 ? # _cell.entry_id 1WJB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WJB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HIV-1 INTEGRASE' 6196.953 2 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD _entity_poly.pdbx_seq_one_letter_code_can FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 LEU n 1 3 ASP n 1 4 GLY n 1 5 ILE n 1 6 ASP n 1 7 LYS n 1 8 ALA n 1 9 GLN n 1 10 GLU n 1 11 GLU n 1 12 HIS n 1 13 GLU n 1 14 LYS n 1 15 TYR n 1 16 HIS n 1 17 SER n 1 18 ASN n 1 19 TRP n 1 20 ARG n 1 21 ALA n 1 22 MET n 1 23 ALA n 1 24 SER n 1 25 ASP n 1 26 PHE n 1 27 ASN n 1 28 LEU n 1 29 PRO n 1 30 PRO n 1 31 VAL n 1 32 VAL n 1 33 ALA n 1 34 LYS n 1 35 GLU n 1 36 ILE n 1 37 VAL n 1 38 ALA n 1 39 SER n 1 40 CYS n 1 41 ASP n 1 42 LYS n 1 43 CYS n 1 44 GLN n 1 45 LEU n 1 46 LYS n 1 47 GLY n 1 48 GLU n 1 49 ALA n 1 50 MET n 1 51 HIS n 1 52 GLY n 1 53 GLN n 1 54 VAL n 1 55 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene POTENTIAL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P12497 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;FFREDLAFPQGKAREFSSEQTRANSPTRRELQVWGRDNNSLSEAGADRQGTVSFSFPQITLWQRPLVTIKIGGQLKEALL DTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVGQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPI ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ DFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMT KILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIV LPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSKDL IAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEY WQATWIPEWEFVNTPPLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQAIHLA LQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDGLVSAGIRKVLFLDGI DKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIE AEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQV RDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKG EGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1WJB A 1 ? 55 ? P12497 716 ? 770 ? 1 55 2 1 1WJB B 1 ? 55 ? P12497 716 ? 770 ? 1 55 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DMX600 Bruker 600 2 DMX500 Bruker 500 3 DMX750 Bruker 750 # _pdbx_nmr_refine.entry_id 1WJB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES WERE CALCULATED USING THE SIMULATED ANNEALING PROTOCOL OF NILGES ET AL. (1988) FEBS LETT. 229, 129 - 136 USING THE PROGRAM XPLOR 3.1 (BRUNGER) MODIFIED TO INCORPORATE COUPLING CONSTANT (GARRETT ET AL. (1984) J. MAGN RESON. SERIES B 104, 99 - 103), CARBON CHEMICAL SHIFT (KUSZEWSKI ET AL. (1995) J. MAGN. RESON. SERIES B 106, 92 - 96) RESTRAINTS AND A CONFORMATIONAL DATABASE POTENTIAL (KUSZEWSKI ET AL. (1996) PROTEIN SCI 5, 1067 - 1080 AND (1997) J. MAGN. RESON. 125, 171-177) THE 3D STRUCTURE OF THE N-TERMINAL DOMAIN OF HIV-1 INTEGRASE WAS SOLVED BY MULTI-DIMENSIONAL HETERONUCLEAR-EDITED AND -FILTERED NMR IS BASED ON 640 EXPERIMENTAL RESTRAINTS (PER MONOMER): (A) INTRASUBUNIT: 156 SEQUENTIAL (|I-J|=1), 137 MEDIUM RANGE (1 < |I-J| >=5) AND 47 LONG RANGE (|I-J| >5) INTERRESIDUE, AND 15 INTRARESIDUE APPROXIMATE INTERPROTON DISTANCE RESTRAINTS; 14 DISTANCE RESTRAINTS FOR 7 HYDROGEN BONDS; 92 TORSION ANGLE (45 PHI, 5 PSI, 30 CHI1 AND 12 CHI2) RESTRAINTS; 36 THREE-BOND HN-HA COUPLING CONSTANT RESTRAINTS; 97 (50 CALPHA AND 47 CBETA) 13C SHIFT RESTRAINTS. (B) 28 INTERSUBUNIT INTERPROTON DISTANCE RESTRAINTS. (C) 23 AMBIGUOUS INTERPROTON DISTANCE RESTRAINTS THAT CAN ARISE FROM INTRA AND/OR INTERSUBUNIT INTERACTIONS. THE STRUCTURES IN THIS ENTRY ARE THE 40 SIMULATED ANNEALING STRUCTURES THE LAST NUMERIC COLUMN IN THE INDIVIDUAL SA STRUCTURES HAS NO MEANING. THE LAST LETTER COLUMN SIGNIFIES THE SUBUNIT (A OR B). RESIDUES 47 - 55 ARE DISORDERED. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WJB _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' 'X-PLOR MODIFIED' MODIFIED ? 2 # _exptl.entry_id 1WJB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WJB _struct.title 'SOLUTION STRUCTURE OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE (D FORM), NMR, 40 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WJB _struct_keywords.pdbx_keywords 'ZN-BINDING PROTEIN' _struct_keywords.text 'ZN-BINDING PROTEIN, AIDS, POLYPROTEIN, HYDROLASE, ASPARTYL PROTEASE, ENDONUCLEASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 2 ? ALA A 8 ? LEU A 2 ALA A 8 1 ? 7 HELX_P HELX_P2 2 LYS A 14 ? SER A 17 ? LYS A 14 SER A 17 1 ? 4 HELX_P HELX_P3 3 TRP A 19 ? PHE A 26 ? TRP A 19 PHE A 26 1 ? 8 HELX_P HELX_P4 4 PRO A 30 ? SER A 39 ? PRO A 30 SER A 39 1 ? 10 HELX_P HELX_P5 5 ASP A 41 ? GLN A 44 ? ASP A 41 GLN A 44 1 ? 4 HELX_P HELX_P6 6 LEU B 2 ? ALA B 8 ? LEU B 2 ALA B 8 1 ? 7 HELX_P HELX_P7 7 LYS B 14 ? SER B 17 ? LYS B 14 SER B 17 1 ? 4 HELX_P HELX_P8 8 TRP B 19 ? PHE B 26 ? TRP B 19 PHE B 26 1 ? 8 HELX_P HELX_P9 9 PRO B 30 ? SER B 39 ? PRO B 30 SER B 39 1 ? 10 HELX_P HELX_P10 10 ASP B 41 ? GLN B 44 ? ASP B 41 GLN B 44 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 12 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 12 A ZN 56 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc2 metalc ? ? A HIS 16 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 16 A ZN 56 1_555 ? ? ? ? ? ? ? 2.182 ? ? metalc3 metalc ? ? A CYS 40 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 40 A ZN 56 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc4 metalc ? ? A CYS 43 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 43 A ZN 56 1_555 ? ? ? ? ? ? ? 2.258 ? ? metalc5 metalc ? ? B HIS 12 ND1 ? ? ? 1_555 D ZN . ZN ? ? B HIS 12 B ZN 56 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc6 metalc ? ? B HIS 16 ND1 ? ? ? 1_555 D ZN . ZN ? ? B HIS 16 B ZN 56 1_555 ? ? ? ? ? ? ? 2.186 ? ? metalc7 metalc ? ? B CYS 40 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 40 B ZN 56 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc8 metalc ? ? B CYS 43 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 43 B ZN 56 1_555 ? ? ? ? ? ? ? 2.257 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 56 ? 4 'BINDING SITE FOR RESIDUE ZN A 56' AC2 Software B ZN 56 ? 4 'BINDING SITE FOR RESIDUE ZN B 56' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 12 ? HIS A 12 . ? 1_555 ? 2 AC1 4 HIS A 16 ? HIS A 16 . ? 1_555 ? 3 AC1 4 CYS A 40 ? CYS A 40 . ? 1_555 ? 4 AC1 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 5 AC2 4 HIS B 12 ? HIS B 12 . ? 1_555 ? 6 AC2 4 HIS B 16 ? HIS B 16 . ? 1_555 ? 7 AC2 4 CYS B 40 ? CYS B 40 . ? 1_555 ? 8 AC2 4 CYS B 43 ? CYS B 43 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WJB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WJB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 1 1 PHE PHE A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n B 1 1 PHE 1 1 1 PHE PHE B . n B 1 2 LEU 2 2 2 LEU LEU B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 GLY 4 4 4 GLY GLY B . n B 1 5 ILE 5 5 5 ILE ILE B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 ALA 8 8 8 ALA ALA B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 HIS 12 12 12 HIS HIS B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 LYS 14 14 14 LYS LYS B . n B 1 15 TYR 15 15 15 TYR TYR B . n B 1 16 HIS 16 16 16 HIS HIS B . n B 1 17 SER 17 17 17 SER SER B . n B 1 18 ASN 18 18 18 ASN ASN B . n B 1 19 TRP 19 19 19 TRP TRP B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 MET 22 22 22 MET MET B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 SER 24 24 24 SER SER B . n B 1 25 ASP 25 25 25 ASP ASP B . n B 1 26 PHE 26 26 26 PHE PHE B . n B 1 27 ASN 27 27 27 ASN ASN B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 PRO 29 29 29 PRO PRO B . n B 1 30 PRO 30 30 30 PRO PRO B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 LYS 34 34 34 LYS LYS B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 VAL 37 37 37 VAL VAL B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 SER 39 39 39 SER SER B . n B 1 40 CYS 40 40 40 CYS CYS B . n B 1 41 ASP 41 41 41 ASP ASP B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 CYS 43 43 43 CYS CYS B . n B 1 44 GLN 44 44 44 GLN GLN B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 GLU 48 48 48 GLU GLU B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 MET 50 50 50 MET MET B . n B 1 51 HIS 51 51 51 HIS HIS B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 GLN 53 53 53 GLN GLN B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 ASP 55 55 55 ASP ASP B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 56 56 ZN ZN A . D 2 ZN 1 56 56 ZN ZN B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? C ZN . ? A ZN 56 ? 1_555 ND1 ? A HIS 16 ? A HIS 16 ? 1_555 107.4 ? 2 ND1 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? C ZN . ? A ZN 56 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 125.2 ? 3 ND1 ? A HIS 16 ? A HIS 16 ? 1_555 ZN ? C ZN . ? A ZN 56 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 118.8 ? 4 ND1 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? C ZN . ? A ZN 56 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 93.7 ? 5 ND1 ? A HIS 16 ? A HIS 16 ? 1_555 ZN ? C ZN . ? A ZN 56 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 105.5 ? 6 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? C ZN . ? A ZN 56 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 100.3 ? 7 ND1 ? B HIS 12 ? B HIS 12 ? 1_555 ZN ? D ZN . ? B ZN 56 ? 1_555 ND1 ? B HIS 16 ? B HIS 16 ? 1_555 107.4 ? 8 ND1 ? B HIS 12 ? B HIS 12 ? 1_555 ZN ? D ZN . ? B ZN 56 ? 1_555 SG ? B CYS 40 ? B CYS 40 ? 1_555 125.2 ? 9 ND1 ? B HIS 16 ? B HIS 16 ? 1_555 ZN ? D ZN . ? B ZN 56 ? 1_555 SG ? B CYS 40 ? B CYS 40 ? 1_555 118.9 ? 10 ND1 ? B HIS 12 ? B HIS 12 ? 1_555 ZN ? D ZN . ? B ZN 56 ? 1_555 SG ? B CYS 43 ? B CYS 43 ? 1_555 93.8 ? 11 ND1 ? B HIS 16 ? B HIS 16 ? 1_555 ZN ? D ZN . ? B ZN 56 ? 1_555 SG ? B CYS 43 ? B CYS 43 ? 1_555 105.4 ? 12 SG ? B CYS 40 ? B CYS 40 ? 1_555 ZN ? D ZN . ? B ZN 56 ? 1_555 SG ? B CYS 43 ? B CYS 43 ? 1_555 100.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-05-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A ILE 5 ? ? H A GLN 9 ? ? 1.59 2 6 O B PRO 30 ? ? H B LYS 34 ? ? 1.52 3 6 O A PRO 30 ? ? H A LYS 34 ? ? 1.52 4 6 O A ILE 5 ? ? H A GLN 9 ? ? 1.56 5 6 O B ILE 5 ? ? H B GLN 9 ? ? 1.58 6 7 O A PRO 30 ? ? H A LYS 34 ? ? 1.56 7 7 O B PRO 30 ? ? H B LYS 34 ? ? 1.56 8 8 O B ILE 5 ? ? H B GLN 9 ? ? 1.50 9 8 O A ILE 5 ? ? H A GLN 9 ? ? 1.51 10 8 O A PRO 30 ? ? H A LYS 34 ? ? 1.54 11 8 O B PRO 30 ? ? H B LYS 34 ? ? 1.56 12 10 O B PRO 30 ? ? H B LYS 34 ? ? 1.53 13 10 O A PRO 30 ? ? H A LYS 34 ? ? 1.53 14 10 O B ILE 5 ? ? H B GLN 9 ? ? 1.53 15 10 O A ILE 5 ? ? H A GLN 9 ? ? 1.54 16 11 O B LYS 14 ? ? HG B SER 17 ? ? 1.51 17 11 O A LYS 14 ? ? HG A SER 17 ? ? 1.52 18 11 O B PRO 30 ? ? H B LYS 34 ? ? 1.54 19 11 O A PRO 30 ? ? H A LYS 34 ? ? 1.55 20 12 O B ILE 5 ? ? H B GLN 9 ? ? 1.58 21 12 O A ILE 5 ? ? H A GLN 9 ? ? 1.58 22 14 O A ILE 5 ? ? H A GLN 9 ? ? 1.53 23 14 O B ILE 5 ? ? H B GLN 9 ? ? 1.54 24 16 O A PRO 30 ? ? H A LYS 34 ? ? 1.50 25 16 O B PRO 30 ? ? H B LYS 34 ? ? 1.50 26 17 O B PRO 30 ? ? H B LYS 34 ? ? 1.52 27 17 O A PRO 30 ? ? H A LYS 34 ? ? 1.52 28 17 O A ILE 5 ? ? H A GLN 9 ? ? 1.60 29 18 OE2 A GLU 35 ? ? HG A SER 39 ? ? 1.55 30 18 OE2 B GLU 35 ? ? HG B SER 39 ? ? 1.55 31 19 O A PRO 30 ? ? H A LYS 34 ? ? 1.50 32 19 O B PRO 30 ? ? H B LYS 34 ? ? 1.52 33 21 O B ILE 5 ? ? H B GLN 9 ? ? 1.53 34 21 O A PRO 30 ? ? H A LYS 34 ? ? 1.55 35 21 O A ILE 5 ? ? H A GLN 9 ? ? 1.56 36 21 O B PRO 30 ? ? H B LYS 34 ? ? 1.58 37 23 O A LYS 14 ? ? HG A SER 17 ? ? 1.52 38 23 O B LYS 14 ? ? HG B SER 17 ? ? 1.53 39 23 O A PRO 30 ? ? H A LYS 34 ? ? 1.57 40 23 O B PRO 30 ? ? H B LYS 34 ? ? 1.57 41 28 O A ILE 5 ? ? H A GLN 9 ? ? 1.58 42 28 O B ILE 5 ? ? H B GLN 9 ? ? 1.59 43 29 O B PRO 30 ? ? H B LYS 34 ? ? 1.57 44 29 O A PRO 30 ? ? H A LYS 34 ? ? 1.58 45 29 O B GLU 11 ? ? H B GLU 13 ? ? 1.58 46 29 O A GLU 11 ? ? H A GLU 13 ? ? 1.59 47 30 O A PRO 30 ? ? H A LYS 34 ? ? 1.57 48 31 O A ILE 5 ? ? H A GLN 9 ? ? 1.53 49 31 O B ILE 5 ? ? H B GLN 9 ? ? 1.54 50 36 O A PRO 30 ? ? H A LYS 34 ? ? 1.51 51 36 O B PRO 30 ? ? H B LYS 34 ? ? 1.52 52 39 O A LYS 14 ? ? HG A SER 17 ? ? 1.56 53 39 O B LYS 14 ? ? HG B SER 17 ? ? 1.57 54 40 O A PRO 30 ? ? H A LYS 34 ? ? 1.58 55 40 O B PRO 30 ? ? H B LYS 34 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 10 ? ? -158.31 -149.61 2 1 GLU A 13 ? ? -100.38 -155.98 3 1 PRO A 30 ? ? -40.23 -18.10 4 1 GLN A 44 ? ? -76.21 -74.53 5 1 LYS A 46 ? ? -90.00 -79.91 6 1 ALA A 49 ? ? -69.66 -92.98 7 1 GLU B 10 ? ? -158.68 -149.55 8 1 GLU B 13 ? ? -100.30 -155.84 9 1 PRO B 30 ? ? -40.22 -18.11 10 1 GLN B 44 ? ? -76.17 -74.43 11 1 LYS B 46 ? ? -90.00 -79.83 12 1 ALA B 49 ? ? -69.79 -93.10 13 2 HIS A 12 ? ? -69.61 72.12 14 2 GLU A 13 ? ? -101.08 -151.19 15 2 PRO A 30 ? ? -40.73 -18.95 16 2 ALA A 49 ? ? 52.11 93.51 17 2 MET A 50 ? ? -115.61 -164.77 18 2 HIS A 51 ? ? 83.53 110.81 19 2 GLN A 53 ? ? 52.83 -167.64 20 2 HIS B 12 ? ? -69.63 71.99 21 2 GLU B 13 ? ? -100.92 -151.12 22 2 PRO B 30 ? ? -40.69 -18.91 23 2 ALA B 49 ? ? 51.94 93.40 24 2 MET B 50 ? ? -115.21 -164.20 25 2 HIS B 51 ? ? 82.67 111.38 26 2 GLN B 53 ? ? 52.77 -167.86 27 3 HIS A 12 ? ? -64.14 75.67 28 3 PRO A 30 ? ? -40.07 -18.77 29 3 GLN A 44 ? ? -79.49 -70.76 30 3 MET A 50 ? ? -70.09 -95.86 31 3 HIS B 12 ? ? -63.71 76.49 32 3 PRO B 30 ? ? -40.27 -18.62 33 3 GLN B 44 ? ? -79.94 -70.73 34 3 MET B 50 ? ? -70.21 -95.97 35 4 GLU A 13 ? ? -101.52 -149.52 36 4 PRO A 30 ? ? -41.85 -18.16 37 4 ALA A 49 ? ? -49.63 173.95 38 4 GLU B 13 ? ? -101.64 -149.74 39 4 PRO B 30 ? ? -41.24 -18.47 40 4 ALA B 49 ? ? -49.92 173.44 41 5 HIS A 12 ? ? -64.47 75.59 42 5 PRO A 30 ? ? -44.76 -15.74 43 5 GLN A 44 ? ? -79.55 -71.29 44 5 HIS B 12 ? ? -63.71 74.70 45 5 PRO B 30 ? ? -44.89 -15.05 46 5 GLN B 44 ? ? -79.71 -71.57 47 6 GLN A 44 ? ? -72.60 -76.03 48 6 ALA A 49 ? ? -60.80 -140.17 49 6 GLN B 44 ? ? -72.49 -75.89 50 6 ALA B 49 ? ? -60.88 -140.33 51 7 HIS A 12 ? ? -63.59 72.58 52 7 GLN A 44 ? ? -79.50 -70.86 53 7 MET A 50 ? ? -90.00 -77.70 54 7 HIS B 12 ? ? -63.27 72.29 55 7 GLN B 44 ? ? -79.40 -70.86 56 7 MET B 50 ? ? -90.03 -77.85 57 8 HIS A 12 ? ? -65.01 70.12 58 8 GLN A 44 ? ? -79.35 -70.49 59 8 HIS B 12 ? ? -64.29 70.01 60 8 GLN B 44 ? ? -77.74 -70.96 61 9 GLU A 11 ? ? -48.19 170.98 62 9 GLN A 44 ? ? -75.88 -74.22 63 9 HIS A 51 ? ? -100.33 -90.09 64 9 GLU B 11 ? ? -48.98 171.21 65 9 GLN B 44 ? ? -76.04 -73.39 66 9 HIS B 51 ? ? -100.44 -90.10 67 10 GLU A 10 ? ? -169.92 -169.57 68 10 HIS A 12 ? ? -64.93 77.11 69 10 PRO A 29 ? ? -45.97 156.19 70 10 GLN A 44 ? ? -72.78 -76.96 71 10 LYS A 46 ? ? -89.98 -78.74 72 10 GLU B 10 ? ? -169.91 -169.69 73 10 HIS B 12 ? ? -65.05 77.10 74 10 PRO B 29 ? ? -45.87 156.00 75 10 GLN B 44 ? ? -72.33 -77.01 76 10 LYS B 46 ? ? -90.04 -78.56 77 11 GLU A 11 ? ? -40.22 160.19 78 11 GLN A 44 ? ? -79.24 -70.14 79 11 LYS A 46 ? ? -92.04 -155.75 80 11 HIS A 51 ? ? 49.76 -174.91 81 11 GLU B 11 ? ? -40.33 160.13 82 11 GLN B 44 ? ? -79.05 -70.24 83 11 LYS B 46 ? ? -91.97 -155.63 84 11 HIS B 51 ? ? 49.67 -174.87 85 12 GLU A 10 ? ? -158.66 -151.27 86 12 GLU A 13 ? ? -100.34 -149.41 87 12 GLN A 44 ? ? -75.79 -75.85 88 12 MET A 50 ? ? -60.20 -111.23 89 12 GLU B 10 ? ? -158.97 -151.06 90 12 GLU B 13 ? ? -100.29 -149.40 91 12 GLN B 44 ? ? -75.66 -75.95 92 12 MET B 50 ? ? -60.22 -111.26 93 13 GLU A 11 ? ? -46.28 162.03 94 13 GLU A 13 ? ? -101.33 -160.17 95 13 PRO A 30 ? ? -42.86 -17.93 96 13 GLN A 44 ? ? -76.87 -71.85 97 13 ALA A 49 ? ? 78.50 80.92 98 13 GLN A 53 ? ? 59.59 18.99 99 13 GLU B 11 ? ? -46.81 162.09 100 13 GLU B 13 ? ? -100.45 -160.52 101 13 PRO B 30 ? ? -43.15 -17.53 102 13 GLN B 44 ? ? -76.01 -71.81 103 13 ALA B 49 ? ? 79.04 81.28 104 14 HIS A 12 ? ? -65.04 69.78 105 14 MET A 50 ? ? 39.80 52.22 106 14 HIS B 12 ? ? -64.94 70.09 107 14 PRO B 30 ? ? -39.82 -20.26 108 14 MET B 50 ? ? 39.57 51.92 109 15 HIS A 12 ? ? -67.55 81.96 110 15 GLN A 44 ? ? -75.07 -78.16 111 15 LYS A 46 ? ? -90.10 -79.90 112 15 VAL A 54 ? ? -141.71 23.19 113 15 HIS B 12 ? ? -65.38 79.40 114 15 PRO B 30 ? ? -41.91 -19.95 115 15 GLN B 44 ? ? -73.48 -77.35 116 15 LYS B 46 ? ? -90.51 -79.26 117 15 VAL B 54 ? ? -142.26 21.29 118 16 GLU A 11 ? ? -43.86 158.81 119 16 HIS A 12 ? ? -69.08 73.05 120 16 GLU B 11 ? ? -43.80 158.66 121 16 HIS B 12 ? ? -68.93 73.12 122 17 GLU A 11 ? ? -44.18 166.56 123 17 HIS A 12 ? ? -69.31 77.35 124 17 MET A 50 ? ? -63.70 -98.32 125 17 GLU B 11 ? ? -44.17 166.57 126 17 HIS B 12 ? ? -69.20 77.30 127 17 MET B 50 ? ? -64.11 -98.44 128 18 HIS A 12 ? ? -57.09 78.98 129 18 GLU A 13 ? ? -101.06 -153.97 130 18 GLN A 44 ? ? -79.02 -70.57 131 18 ALA A 49 ? ? 81.49 113.26 132 18 HIS B 12 ? ? -57.10 79.10 133 18 GLU B 13 ? ? -101.22 -153.89 134 18 GLN B 44 ? ? -79.23 -70.45 135 18 ALA B 49 ? ? 81.51 112.99 136 19 GLU A 13 ? ? -100.35 -160.83 137 19 GLU A 48 ? ? 54.82 -169.32 138 19 HIS B 12 ? ? -69.62 79.40 139 19 GLU B 13 ? ? -100.31 -162.63 140 19 GLU B 48 ? ? 53.52 -167.49 141 20 GLU A 13 ? ? -102.17 -149.71 142 20 MET A 50 ? ? 55.73 108.83 143 20 HIS B 12 ? ? -69.84 71.62 144 20 GLU B 13 ? ? -100.82 -149.66 145 20 MET B 50 ? ? 54.77 110.42 146 21 HIS A 12 ? ? -64.71 71.63 147 21 GLN A 44 ? ? -76.25 -71.60 148 21 ALA A 49 ? ? -159.85 29.00 149 21 HIS B 12 ? ? -64.44 73.10 150 21 ALA B 49 ? ? -160.92 30.68 151 22 HIS A 12 ? ? -65.91 70.70 152 22 GLU A 13 ? ? -101.07 -149.75 153 22 GLU A 48 ? ? -71.76 45.41 154 22 HIS B 12 ? ? -67.25 71.91 155 22 GLU B 13 ? ? -101.73 -149.79 156 22 GLU B 48 ? ? -73.86 44.36 157 23 HIS A 12 ? ? -62.91 78.05 158 23 GLU A 13 ? ? -100.59 -159.35 159 23 GLN A 44 ? ? -77.11 -74.25 160 23 GLU A 48 ? ? -74.64 -164.66 161 23 GLN A 53 ? ? 50.00 -150.64 162 23 HIS B 12 ? ? -62.92 78.01 163 23 GLU B 13 ? ? -100.47 -159.29 164 23 GLN B 44 ? ? -77.02 -74.36 165 23 GLU B 48 ? ? -74.79 -164.69 166 23 GLN B 53 ? ? 49.99 -150.56 167 24 GLU A 11 ? ? -49.34 170.00 168 24 GLN A 44 ? ? -79.41 -70.01 169 24 ALA A 49 ? ? 52.99 -163.44 170 24 MET A 50 ? ? -146.72 -68.22 171 24 HIS A 51 ? ? 58.18 -150.71 172 24 GLU B 11 ? ? -49.51 169.94 173 24 HIS B 12 ? ? -69.99 79.04 174 24 GLN B 44 ? ? -79.55 -70.01 175 24 ALA B 49 ? ? 52.83 -163.50 176 24 MET B 50 ? ? -146.66 -68.24 177 24 HIS B 51 ? ? 58.13 -150.54 178 25 HIS A 12 ? ? -64.02 71.55 179 25 ALA A 49 ? ? -144.92 -57.95 180 25 HIS B 12 ? ? -64.88 72.66 181 25 ALA B 49 ? ? -145.61 -56.73 182 26 GLU A 11 ? ? -46.48 157.13 183 26 HIS A 12 ? ? -66.89 67.67 184 26 PRO A 30 ? ? -42.44 -18.30 185 26 GLN A 44 ? ? -79.74 -70.18 186 26 MET A 50 ? ? -170.00 131.72 187 26 GLU B 11 ? ? -46.85 157.49 188 26 HIS B 12 ? ? -67.22 67.56 189 26 PRO B 30 ? ? -42.14 -18.46 190 26 GLN B 44 ? ? -79.86 -70.01 191 27 HIS A 12 ? ? -65.32 72.57 192 27 PRO A 30 ? ? -41.83 -17.35 193 27 GLN A 44 ? ? -77.96 -70.09 194 27 ALA A 49 ? ? -108.86 56.05 195 27 HIS B 12 ? ? -64.94 72.51 196 27 PRO B 30 ? ? -42.13 -17.24 197 27 GLN B 44 ? ? -77.16 -70.02 198 27 ALA B 49 ? ? -108.75 54.96 199 28 HIS A 12 ? ? -67.45 69.99 200 28 GLU A 13 ? ? -100.95 -151.91 201 28 GLU A 48 ? ? 49.16 86.36 202 28 MET A 50 ? ? -167.04 -51.93 203 28 HIS B 12 ? ? -66.25 70.52 204 28 GLU B 13 ? ? -101.91 -151.63 205 28 GLU B 48 ? ? 51.47 87.29 206 28 MET B 50 ? ? -164.12 -51.33 207 29 GLU A 11 ? ? -46.53 156.45 208 29 HIS A 12 ? ? -65.19 66.49 209 29 GLN A 44 ? ? -79.81 -71.39 210 29 HIS A 51 ? ? 66.65 -166.95 211 29 GLU B 11 ? ? -47.18 156.38 212 29 HIS B 12 ? ? -65.01 66.65 213 29 GLN B 44 ? ? -79.92 -71.11 214 29 HIS B 51 ? ? 66.81 -167.31 215 30 HIS A 12 ? ? -65.96 77.64 216 30 GLN A 44 ? ? -74.44 -75.53 217 30 MET A 50 ? ? -159.15 -1.25 218 30 HIS B 12 ? ? -65.83 77.68 219 30 PRO B 30 ? ? -39.74 -21.10 220 30 GLN B 44 ? ? -75.36 -75.73 221 30 MET B 50 ? ? -162.13 4.37 222 31 GLU A 13 ? ? -101.13 -166.64 223 31 ALA A 49 ? ? -146.89 -135.46 224 31 GLN B 44 ? ? -79.61 -70.17 225 31 ALA B 49 ? ? -147.78 -131.14 226 32 HIS A 12 ? ? -69.47 70.46 227 32 GLN A 44 ? ? -73.78 -77.70 228 32 ALA A 49 ? ? -90.22 -77.44 229 32 HIS B 12 ? ? -65.23 71.31 230 32 GLN B 44 ? ? -75.19 -77.66 231 32 ALA B 49 ? ? -90.83 -78.33 232 33 HIS A 12 ? ? -65.80 81.53 233 33 GLU A 13 ? ? -100.82 -163.00 234 33 PRO A 30 ? ? -42.16 -15.73 235 33 GLN A 44 ? ? -79.81 -70.02 236 33 ALA A 49 ? ? 50.11 -149.90 237 33 HIS B 12 ? ? -67.07 80.37 238 33 PRO B 30 ? ? -41.61 -17.85 239 33 ALA B 49 ? ? 51.04 -146.21 240 34 GLU A 13 ? ? -101.53 -151.44 241 34 PRO A 30 ? ? -41.65 -17.69 242 34 GLN A 44 ? ? -79.56 -71.79 243 34 ALA A 49 ? ? 47.36 -175.12 244 34 GLU B 13 ? ? -101.37 -151.44 245 34 PRO B 30 ? ? -41.57 -17.72 246 34 GLN B 44 ? ? -79.53 -71.91 247 34 ALA B 49 ? ? 47.31 -175.02 248 35 HIS A 12 ? ? -63.30 82.63 249 35 ALA A 49 ? ? -89.99 -73.09 250 35 HIS A 51 ? ? 59.92 -160.63 251 35 GLN A 53 ? ? 64.92 68.31 252 35 HIS B 12 ? ? -64.43 81.96 253 35 ALA B 49 ? ? -90.01 -72.62 254 35 HIS B 51 ? ? 61.07 -159.97 255 35 GLN B 53 ? ? 64.60 68.22 256 36 GLU A 13 ? ? -101.92 -150.97 257 36 PRO A 30 ? ? -38.85 -25.22 258 36 GLN A 44 ? ? -75.13 -77.75 259 36 ALA A 49 ? ? 71.07 -65.65 260 36 GLU B 13 ? ? -101.62 -151.22 261 36 PRO B 30 ? ? -38.94 -25.62 262 36 GLN B 44 ? ? -74.35 -77.81 263 36 ALA B 49 ? ? 68.69 -64.71 264 37 GLU A 13 ? ? -102.38 -162.57 265 37 GLN A 44 ? ? -74.82 -72.56 266 37 LYS A 46 ? ? -89.98 -79.98 267 37 GLU B 13 ? ? -102.06 -162.61 268 37 GLN B 44 ? ? -75.05 -72.31 269 37 LYS B 46 ? ? -90.11 -79.95 270 38 HIS A 12 ? ? -66.03 80.08 271 38 GLU A 13 ? ? -101.01 -156.63 272 38 PRO A 30 ? ? -40.76 -18.88 273 38 GLN A 44 ? ? -79.55 -70.04 274 38 HIS B 12 ? ? -66.51 80.19 275 38 GLU B 13 ? ? -101.07 -156.58 276 38 PRO B 30 ? ? -40.62 -19.03 277 38 GLN B 44 ? ? -79.57 -70.07 278 39 GLU A 11 ? ? -43.48 162.52 279 39 PRO A 30 ? ? -42.55 -17.16 280 39 GLU B 11 ? ? -43.80 162.62 281 39 PRO B 30 ? ? -42.80 -17.12 282 40 GLU A 13 ? ? -100.86 -156.44 283 40 GLN A 44 ? ? -75.97 -71.44 284 40 VAL A 54 ? ? -150.58 15.76 285 40 GLU B 13 ? ? -100.97 -156.72 286 40 GLN B 44 ? ? -76.23 -71.19 287 40 VAL B 54 ? ? -150.69 15.36 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #